Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4TJZ2

Protein Details
Accession A0A4Q4TJZ2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-38LPSLHVPDRKRRGDQRRRIQWRFRECNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5cyto_nucl 10.5, cyto 9.5, pero 3, mito 2, plas 2
Family & Domain DBs
Amino Acid Sequences MGGFDRFHELLPSLHVPDRKRRGDQRRRIQWRFRECNIPDIWRAFACGIVGHPVFSHNLVVVNKFKTHRHFYTQCHIYINSLVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.29
4 0.38
5 0.46
6 0.47
7 0.53
8 0.6
9 0.68
10 0.74
11 0.82
12 0.83
13 0.84
14 0.89
15 0.89
16 0.87
17 0.85
18 0.85
19 0.82
20 0.73
21 0.72
22 0.62
23 0.61
24 0.54
25 0.47
26 0.38
27 0.32
28 0.3
29 0.2
30 0.2
31 0.14
32 0.12
33 0.09
34 0.08
35 0.07
36 0.09
37 0.09
38 0.08
39 0.08
40 0.09
41 0.1
42 0.1
43 0.1
44 0.07
45 0.11
46 0.12
47 0.15
48 0.18
49 0.19
50 0.22
51 0.25
52 0.29
53 0.32
54 0.4
55 0.42
56 0.48
57 0.53
58 0.55
59 0.63
60 0.63
61 0.58
62 0.54
63 0.49
64 0.42