Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XB67

Protein Details
Accession A0A4V1XB67    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-82LGDREERARRARDRQRARGRAEYSBasic
NLS Segment(s)
PositionSequence
66-76ARRARDRQRAR
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MATFLEDPRLRQRWNQISQTTETVTENAAAGIWSFGHTYITPCLASVGSAFDSCTTVCLGDREERARRARDRQRARGRAEYSFDFYDDWDEELFGEEPGGSTWGGWRSEDWDRLLAGTGKRRNVPGEVTEQPRGKKRGMSYGTRGVRKTATGEEDPTIIPSTTPIGFLGRLPFKLGGTLRYKPSAANLQDHPGALRMVHDGEHEPLLGPEEDGEGSHSEDEPRAQTRKRSGTSGSGNTSDSYRSRGDLFPSDGEGEEDAVPLGDDLGVMLDRVDDRLSNRTRSSKGKKVAESGIARSASRTTISSALSSLRGKRSFASNPQSPLVGSAPSLEDLRQEEERLEREEDQALEKKRQAAADLALRRGLSRENLQIASVPEAKTEMVRVEDVHTPESAVIEEVTADDGDVESASEPTLTELHPPETPAAPNKPPDSEFVPARLPYFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.64
4 0.63
5 0.64
6 0.62
7 0.53
8 0.45
9 0.38
10 0.3
11 0.26
12 0.22
13 0.18
14 0.13
15 0.11
16 0.09
17 0.08
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.1
24 0.1
25 0.13
26 0.15
27 0.17
28 0.16
29 0.15
30 0.16
31 0.14
32 0.14
33 0.12
34 0.12
35 0.11
36 0.11
37 0.12
38 0.11
39 0.12
40 0.12
41 0.12
42 0.1
43 0.09
44 0.1
45 0.11
46 0.14
47 0.18
48 0.24
49 0.3
50 0.35
51 0.42
52 0.48
53 0.54
54 0.58
55 0.63
56 0.68
57 0.72
58 0.76
59 0.8
60 0.85
61 0.85
62 0.85
63 0.83
64 0.77
65 0.72
66 0.67
67 0.59
68 0.53
69 0.45
70 0.39
71 0.3
72 0.26
73 0.25
74 0.2
75 0.18
76 0.13
77 0.12
78 0.11
79 0.13
80 0.13
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.09
87 0.06
88 0.05
89 0.09
90 0.13
91 0.13
92 0.14
93 0.14
94 0.17
95 0.23
96 0.26
97 0.25
98 0.23
99 0.22
100 0.22
101 0.24
102 0.23
103 0.22
104 0.27
105 0.3
106 0.32
107 0.34
108 0.36
109 0.36
110 0.35
111 0.34
112 0.29
113 0.3
114 0.32
115 0.35
116 0.39
117 0.4
118 0.41
119 0.45
120 0.45
121 0.41
122 0.4
123 0.38
124 0.43
125 0.45
126 0.48
127 0.46
128 0.52
129 0.57
130 0.56
131 0.53
132 0.45
133 0.41
134 0.36
135 0.33
136 0.27
137 0.26
138 0.23
139 0.25
140 0.23
141 0.23
142 0.22
143 0.2
144 0.18
145 0.12
146 0.1
147 0.09
148 0.1
149 0.09
150 0.1
151 0.09
152 0.09
153 0.09
154 0.1
155 0.15
156 0.15
157 0.15
158 0.16
159 0.16
160 0.15
161 0.19
162 0.18
163 0.19
164 0.22
165 0.25
166 0.26
167 0.27
168 0.27
169 0.23
170 0.26
171 0.28
172 0.25
173 0.26
174 0.25
175 0.26
176 0.27
177 0.27
178 0.24
179 0.17
180 0.15
181 0.1
182 0.1
183 0.08
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.1
190 0.09
191 0.08
192 0.07
193 0.09
194 0.08
195 0.06
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.06
202 0.06
203 0.07
204 0.07
205 0.06
206 0.07
207 0.08
208 0.08
209 0.11
210 0.14
211 0.16
212 0.2
213 0.27
214 0.34
215 0.35
216 0.36
217 0.35
218 0.38
219 0.42
220 0.42
221 0.37
222 0.31
223 0.3
224 0.27
225 0.25
226 0.2
227 0.15
228 0.15
229 0.13
230 0.13
231 0.15
232 0.16
233 0.18
234 0.19
235 0.21
236 0.18
237 0.19
238 0.18
239 0.15
240 0.15
241 0.12
242 0.1
243 0.08
244 0.07
245 0.06
246 0.05
247 0.05
248 0.04
249 0.04
250 0.03
251 0.02
252 0.02
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.04
260 0.05
261 0.05
262 0.07
263 0.16
264 0.19
265 0.22
266 0.25
267 0.3
268 0.34
269 0.43
270 0.49
271 0.5
272 0.56
273 0.6
274 0.59
275 0.59
276 0.59
277 0.56
278 0.51
279 0.44
280 0.41
281 0.35
282 0.32
283 0.28
284 0.25
285 0.18
286 0.17
287 0.15
288 0.12
289 0.14
290 0.15
291 0.15
292 0.15
293 0.15
294 0.17
295 0.19
296 0.21
297 0.25
298 0.26
299 0.26
300 0.27
301 0.32
302 0.35
303 0.41
304 0.45
305 0.43
306 0.45
307 0.45
308 0.44
309 0.37
310 0.33
311 0.26
312 0.18
313 0.13
314 0.11
315 0.11
316 0.12
317 0.12
318 0.1
319 0.11
320 0.12
321 0.16
322 0.16
323 0.15
324 0.16
325 0.19
326 0.22
327 0.23
328 0.25
329 0.22
330 0.23
331 0.25
332 0.25
333 0.26
334 0.31
335 0.3
336 0.32
337 0.33
338 0.36
339 0.36
340 0.36
341 0.33
342 0.29
343 0.3
344 0.34
345 0.35
346 0.32
347 0.31
348 0.3
349 0.28
350 0.26
351 0.24
352 0.2
353 0.21
354 0.26
355 0.28
356 0.29
357 0.29
358 0.3
359 0.29
360 0.3
361 0.29
362 0.23
363 0.19
364 0.2
365 0.2
366 0.18
367 0.18
368 0.14
369 0.13
370 0.14
371 0.14
372 0.17
373 0.22
374 0.23
375 0.23
376 0.21
377 0.19
378 0.19
379 0.18
380 0.15
381 0.11
382 0.09
383 0.07
384 0.07
385 0.07
386 0.08
387 0.07
388 0.06
389 0.06
390 0.06
391 0.06
392 0.06
393 0.06
394 0.05
395 0.06
396 0.06
397 0.06
398 0.06
399 0.07
400 0.09
401 0.09
402 0.14
403 0.17
404 0.2
405 0.21
406 0.22
407 0.24
408 0.25
409 0.28
410 0.3
411 0.34
412 0.37
413 0.43
414 0.45
415 0.47
416 0.45
417 0.46
418 0.44
419 0.43
420 0.4
421 0.38
422 0.4
423 0.36