Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T7V1

Protein Details
Accession A0A4Q4T7V1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
133-156YGDATPTKKRQRRTPATKKRATVFHydrophilic
NLS Segment(s)
PositionSequence
140-152KKRQRRTPATKKR
Subcellular Location(s) cyto 11, nucl 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MADSNNTNEGAGGKWTDAEKVSMMVQIIEQLTSAGGKVRLGDLNMPGRTQKSLTHMLGKIKDEAAAYKGEGGNDSGSVPATPKAKTGPKKGVSSASAKGTGTGTGTGGRKRTKTAAAATGSDAGDDGEKDGDYGDATPTKKRQRRTPATKKRATVFKSEPKAEDTVSEDGEDEKKPDAAALEAADAVNAAIAAANGAAAMDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.15
5 0.15
6 0.14
7 0.14
8 0.15
9 0.14
10 0.14
11 0.12
12 0.11
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.25
31 0.25
32 0.25
33 0.24
34 0.24
35 0.24
36 0.23
37 0.21
38 0.2
39 0.27
40 0.28
41 0.33
42 0.35
43 0.39
44 0.42
45 0.4
46 0.36
47 0.29
48 0.29
49 0.22
50 0.2
51 0.16
52 0.13
53 0.12
54 0.13
55 0.13
56 0.12
57 0.12
58 0.12
59 0.1
60 0.1
61 0.1
62 0.07
63 0.07
64 0.06
65 0.07
66 0.09
67 0.1
68 0.1
69 0.11
70 0.15
71 0.23
72 0.29
73 0.35
74 0.42
75 0.45
76 0.47
77 0.48
78 0.48
79 0.43
80 0.41
81 0.36
82 0.29
83 0.25
84 0.22
85 0.21
86 0.17
87 0.15
88 0.11
89 0.09
90 0.07
91 0.09
92 0.11
93 0.12
94 0.16
95 0.18
96 0.18
97 0.2
98 0.23
99 0.22
100 0.25
101 0.26
102 0.28
103 0.27
104 0.27
105 0.26
106 0.26
107 0.22
108 0.18
109 0.15
110 0.09
111 0.08
112 0.07
113 0.07
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.1
123 0.11
124 0.15
125 0.22
126 0.32
127 0.37
128 0.43
129 0.51
130 0.59
131 0.69
132 0.77
133 0.81
134 0.82
135 0.88
136 0.89
137 0.84
138 0.79
139 0.77
140 0.69
141 0.67
142 0.64
143 0.63
144 0.64
145 0.62
146 0.57
147 0.51
148 0.5
149 0.41
150 0.35
151 0.29
152 0.24
153 0.22
154 0.2
155 0.17
156 0.17
157 0.19
158 0.18
159 0.15
160 0.14
161 0.13
162 0.13
163 0.14
164 0.13
165 0.12
166 0.12
167 0.12
168 0.11
169 0.11
170 0.11
171 0.1
172 0.09
173 0.07
174 0.05
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03