Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T3E0

Protein Details
Accession A0A4Q4T3E0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPQGPKKNEPLPTTBasic
NLS Segment(s)
PositionSequence
3-16KRKKSSRKPQGPKK
Subcellular Location(s) cyto_mito 13.166, cyto 13, mito 12, cyto_nucl 8.166, mito_nucl 7.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPKKNEPLPTTFTCLFCNHEKAVTVKMDKKAGVGQLDCKVCGQKFQCGINYLSAAVDVYSEWVDAADAVAKEDASGRIPSSTSGHRQGMRQSAADADEDEDGGYEGEGIVADEDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.9
4 0.86
5 0.78
6 0.72
7 0.67
8 0.61
9 0.58
10 0.51
11 0.43
12 0.38
13 0.35
14 0.35
15 0.32
16 0.33
17 0.27
18 0.25
19 0.25
20 0.24
21 0.27
22 0.27
23 0.28
24 0.29
25 0.32
26 0.33
27 0.31
28 0.31
29 0.3
30 0.28
31 0.27
32 0.22
33 0.22
34 0.25
35 0.25
36 0.24
37 0.22
38 0.22
39 0.18
40 0.23
41 0.21
42 0.21
43 0.24
44 0.26
45 0.28
46 0.27
47 0.28
48 0.24
49 0.22
50 0.17
51 0.13
52 0.11
53 0.08
54 0.06
55 0.05
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.04
65 0.05
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.1
77 0.1
78 0.12
79 0.14
80 0.17
81 0.2
82 0.25
83 0.3
84 0.31
85 0.33
86 0.37
87 0.42
88 0.4
89 0.35
90 0.3
91 0.28
92 0.27
93 0.25
94 0.2
95 0.14
96 0.12
97 0.11
98 0.1
99 0.09
100 0.08
101 0.07
102 0.06
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04