Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4T107

Protein Details
Accession A0A4Q4T107    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-61SSPPPPPPPRPKKRHIYVNRBasic
NLS Segment(s)
PositionSequence
44-55PPPPPPPRPKKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPYTAKTSRRFSQHISGSPAPGGPSRYYTESGPRRAGPQGMSSPPPPPPPRPKKRHIYVNRDLPEGALSRNPEPARIETELGETKLRGEQEEEESQSAAQAADVQPWQGTIGRLRDYVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.57
4 0.51
5 0.47
6 0.42
7 0.34
8 0.28
9 0.25
10 0.18
11 0.19
12 0.21
13 0.24
14 0.25
15 0.25
16 0.32
17 0.36
18 0.4
19 0.4
20 0.37
21 0.37
22 0.37
23 0.38
24 0.3
25 0.28
26 0.27
27 0.26
28 0.28
29 0.26
30 0.26
31 0.26
32 0.32
33 0.3
34 0.33
35 0.42
36 0.5
37 0.6
38 0.65
39 0.71
40 0.73
41 0.78
42 0.81
43 0.8
44 0.78
45 0.76
46 0.78
47 0.72
48 0.63
49 0.55
50 0.44
51 0.36
52 0.27
53 0.19
54 0.12
55 0.12
56 0.12
57 0.18
58 0.18
59 0.18
60 0.2
61 0.21
62 0.23
63 0.23
64 0.23
65 0.18
66 0.22
67 0.22
68 0.21
69 0.2
70 0.15
71 0.14
72 0.16
73 0.16
74 0.13
75 0.13
76 0.15
77 0.2
78 0.24
79 0.25
80 0.23
81 0.23
82 0.22
83 0.2
84 0.18
85 0.12
86 0.08
87 0.09
88 0.08
89 0.11
90 0.12
91 0.12
92 0.12
93 0.12
94 0.14
95 0.12
96 0.14
97 0.16
98 0.22
99 0.24
100 0.25