Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T016

Protein Details
Accession A0A4Q4T016   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41GALKLKGAKVQKPKKKKKDKPSNNLERSLSHydrophilic
52-73TSSSKEVEKKDKKKRQDDSDGGBasic
NLS Segment(s)
PositionSequence
15-32KLKGAKVQKPKKKKKDKP
63-64KK
Subcellular Location(s) nucl 23, mito_nucl 13.333, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGADDYAVAGGGALKLKGAKVQKPKKKKKDKPSNNLERSLSVIEGDDDPKATSSSKEVEKKDKKKRQDDSDGGAEEPEKSDQHTVEYKTEAERRHEEIQRRKLLKMFEDGSAKPELLKTHKERVEGLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.14
5 0.2
6 0.26
7 0.36
8 0.47
9 0.57
10 0.68
11 0.79
12 0.84
13 0.9
14 0.93
15 0.93
16 0.94
17 0.95
18 0.95
19 0.95
20 0.95
21 0.89
22 0.85
23 0.75
24 0.64
25 0.56
26 0.46
27 0.35
28 0.24
29 0.18
30 0.13
31 0.13
32 0.12
33 0.09
34 0.09
35 0.09
36 0.09
37 0.1
38 0.09
39 0.08
40 0.1
41 0.14
42 0.2
43 0.26
44 0.29
45 0.39
46 0.48
47 0.58
48 0.67
49 0.71
50 0.74
51 0.77
52 0.82
53 0.8
54 0.8
55 0.74
56 0.68
57 0.64
58 0.56
59 0.46
60 0.37
61 0.28
62 0.19
63 0.15
64 0.12
65 0.07
66 0.07
67 0.09
68 0.09
69 0.12
70 0.16
71 0.17
72 0.17
73 0.19
74 0.18
75 0.2
76 0.25
77 0.24
78 0.26
79 0.27
80 0.31
81 0.37
82 0.42
83 0.47
84 0.53
85 0.6
86 0.64
87 0.63
88 0.59
89 0.55
90 0.53
91 0.47
92 0.44
93 0.37
94 0.32
95 0.34
96 0.32
97 0.31
98 0.29
99 0.26
100 0.2
101 0.2
102 0.2
103 0.2
104 0.29
105 0.31
106 0.4
107 0.43
108 0.45
109 0.46
110 0.48
111 0.51
112 0.45
113 0.42
114 0.4
115 0.37
116 0.37
117 0.35
118 0.3
119 0.22
120 0.21
121 0.22
122 0.22
123 0.24
124 0.29
125 0.33
126 0.34