Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T560

Protein Details
Accession A0A4Q4T560    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-28ALRQRAACVVRRRKPPTPRNIRSYASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR034444  Nuo17.8  
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MQALRQRAACVVRRRKPPTPRNIRSYASESHGHGDHHHHTAPQVAEGLGPAFYIFAGAIPVSWFVYSVSRPGEDGEPSSFNRWLRGFEYLSGTWQERNAIRTAAIEQAAHDKHLFLNSGKNPHIELKMPELIGSGSPYAVPAGHYPKLDHVTEHYRQKYVEEEERKAKRLLEKKGQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.82
4 0.84
5 0.85
6 0.86
7 0.86
8 0.83
9 0.82
10 0.75
11 0.7
12 0.65
13 0.57
14 0.5
15 0.45
16 0.38
17 0.35
18 0.34
19 0.29
20 0.26
21 0.28
22 0.27
23 0.28
24 0.27
25 0.24
26 0.23
27 0.27
28 0.26
29 0.21
30 0.18
31 0.14
32 0.13
33 0.12
34 0.12
35 0.07
36 0.06
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.08
53 0.08
54 0.1
55 0.1
56 0.1
57 0.11
58 0.12
59 0.13
60 0.11
61 0.13
62 0.13
63 0.14
64 0.14
65 0.17
66 0.18
67 0.16
68 0.19
69 0.18
70 0.18
71 0.17
72 0.2
73 0.18
74 0.17
75 0.21
76 0.17
77 0.18
78 0.17
79 0.17
80 0.13
81 0.13
82 0.15
83 0.11
84 0.13
85 0.13
86 0.12
87 0.12
88 0.12
89 0.13
90 0.13
91 0.12
92 0.1
93 0.1
94 0.15
95 0.15
96 0.15
97 0.14
98 0.12
99 0.12
100 0.14
101 0.15
102 0.1
103 0.17
104 0.2
105 0.25
106 0.26
107 0.26
108 0.26
109 0.28
110 0.3
111 0.25
112 0.23
113 0.24
114 0.26
115 0.25
116 0.23
117 0.2
118 0.18
119 0.16
120 0.16
121 0.1
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.08
128 0.1
129 0.16
130 0.19
131 0.2
132 0.21
133 0.26
134 0.3
135 0.3
136 0.27
137 0.27
138 0.32
139 0.38
140 0.46
141 0.44
142 0.42
143 0.41
144 0.42
145 0.43
146 0.42
147 0.45
148 0.43
149 0.46
150 0.54
151 0.59
152 0.61
153 0.57
154 0.54
155 0.54
156 0.56
157 0.6