Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N9H3

Protein Details
Accession G9N9H3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-131VARKRIARRAPPRGVNKRRRDDSBasic
NLS Segment(s)
PositionSequence
93-128LRSRAAKTDGKGDETPVARKRIARRAPPRGVNKRRR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MLLPSAFSCDGGSQAAPRARSQAGRFVSPPASPSTLSAQYSIDNIMNTCRSLQSLISMTTSNTDHSALAPAPTLTQLPTPPLAHAPTPMKLRLRSRAAKTDGKGDETPVARKRIARRAPPRGVNKRRRDDSDDMGRNDESDMDTEAELDVETLHIPPLSSSSPQAPSTPKRARISPEQLPLGLERSDFHNVHLLEGSALDQDTEKPGTDVQVEADGTEWSVEDDRVLVELVLEKLKLSKMEWQDCARSLGKDRHSVNRRWKSLITNGDIGVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.23
4 0.23
5 0.27
6 0.28
7 0.34
8 0.35
9 0.37
10 0.37
11 0.4
12 0.4
13 0.4
14 0.39
15 0.34
16 0.33
17 0.28
18 0.28
19 0.24
20 0.25
21 0.26
22 0.28
23 0.29
24 0.28
25 0.24
26 0.22
27 0.23
28 0.22
29 0.18
30 0.13
31 0.13
32 0.15
33 0.15
34 0.15
35 0.15
36 0.14
37 0.14
38 0.15
39 0.14
40 0.15
41 0.16
42 0.17
43 0.17
44 0.17
45 0.16
46 0.17
47 0.18
48 0.15
49 0.13
50 0.13
51 0.11
52 0.11
53 0.14
54 0.12
55 0.12
56 0.11
57 0.1
58 0.1
59 0.1
60 0.1
61 0.08
62 0.1
63 0.1
64 0.11
65 0.15
66 0.15
67 0.15
68 0.17
69 0.18
70 0.17
71 0.21
72 0.21
73 0.22
74 0.25
75 0.28
76 0.29
77 0.33
78 0.37
79 0.41
80 0.46
81 0.49
82 0.51
83 0.56
84 0.58
85 0.59
86 0.55
87 0.55
88 0.49
89 0.46
90 0.41
91 0.34
92 0.33
93 0.28
94 0.33
95 0.28
96 0.3
97 0.26
98 0.3
99 0.35
100 0.41
101 0.47
102 0.51
103 0.56
104 0.63
105 0.69
106 0.73
107 0.76
108 0.77
109 0.81
110 0.81
111 0.81
112 0.8
113 0.78
114 0.75
115 0.72
116 0.65
117 0.62
118 0.62
119 0.58
120 0.5
121 0.47
122 0.42
123 0.34
124 0.3
125 0.23
126 0.13
127 0.08
128 0.08
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.05
136 0.04
137 0.03
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.06
145 0.07
146 0.08
147 0.09
148 0.12
149 0.15
150 0.16
151 0.18
152 0.21
153 0.24
154 0.33
155 0.38
156 0.43
157 0.42
158 0.45
159 0.47
160 0.51
161 0.55
162 0.52
163 0.52
164 0.45
165 0.43
166 0.4
167 0.36
168 0.3
169 0.22
170 0.16
171 0.11
172 0.14
173 0.19
174 0.18
175 0.19
176 0.23
177 0.22
178 0.23
179 0.23
180 0.19
181 0.13
182 0.13
183 0.13
184 0.07
185 0.07
186 0.06
187 0.06
188 0.06
189 0.09
190 0.1
191 0.09
192 0.09
193 0.1
194 0.11
195 0.12
196 0.12
197 0.1
198 0.13
199 0.12
200 0.11
201 0.12
202 0.1
203 0.09
204 0.09
205 0.08
206 0.06
207 0.07
208 0.07
209 0.06
210 0.07
211 0.07
212 0.08
213 0.08
214 0.06
215 0.06
216 0.08
217 0.1
218 0.1
219 0.1
220 0.1
221 0.11
222 0.13
223 0.15
224 0.14
225 0.21
226 0.29
227 0.35
228 0.41
229 0.44
230 0.46
231 0.47
232 0.5
233 0.44
234 0.39
235 0.39
236 0.42
237 0.43
238 0.47
239 0.49
240 0.55
241 0.6
242 0.66
243 0.7
244 0.72
245 0.71
246 0.68
247 0.68
248 0.64
249 0.66
250 0.66
251 0.61
252 0.54