Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SZ60

Protein Details
Accession A0A4Q4SZ60   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-22PSDRRVEKSNQKPQRPESAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPSDRRVEKSNQKPQRPESAKLDQSLMQELTNPLKFRVRLPASVPFGLYVLPYRLSIANNFNFWLEKVETDQGVEIEVSDMMQTGQARDLSEFIDTSFGDYSLKMHAKFHHKKEWEELFKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.79
3 0.82
4 0.77
5 0.72
6 0.69
7 0.69
8 0.63
9 0.57
10 0.54
11 0.46
12 0.42
13 0.39
14 0.32
15 0.22
16 0.2
17 0.2
18 0.23
19 0.23
20 0.22
21 0.2
22 0.24
23 0.25
24 0.25
25 0.33
26 0.31
27 0.3
28 0.33
29 0.4
30 0.39
31 0.39
32 0.37
33 0.27
34 0.24
35 0.21
36 0.18
37 0.1
38 0.07
39 0.08
40 0.07
41 0.08
42 0.09
43 0.1
44 0.12
45 0.16
46 0.16
47 0.16
48 0.16
49 0.15
50 0.14
51 0.14
52 0.15
53 0.1
54 0.09
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.08
61 0.08
62 0.08
63 0.06
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.03
70 0.06
71 0.06
72 0.06
73 0.08
74 0.09
75 0.1
76 0.1
77 0.11
78 0.1
79 0.11
80 0.1
81 0.08
82 0.1
83 0.09
84 0.11
85 0.1
86 0.1
87 0.09
88 0.09
89 0.1
90 0.15
91 0.19
92 0.18
93 0.21
94 0.28
95 0.38
96 0.48
97 0.54
98 0.57
99 0.58
100 0.62
101 0.68
102 0.72
103 0.72