Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4T4F1

Protein Details
Accession A0A4Q4T4F1   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-34AAEAKRWFRRVPEKQRRRGGRSCDLCHydrophilic
NLS Segment(s)
PositionSequence
16-27FRRVPEKQRRRG
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 6.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Amino Acid Sequences MHPSSTASAAEAKRWFRRVPEKQRRRGGRSCDLCSGGSGGRGPDQRPVHDIVVRAGRAPRRLLDPEWRPLQHRGLRDLVQRDDGAGLGDQGRQLGAVQPLRDVGAARAEALGAVQSFEDAATPRRCLALGLNLRDALKRYEEIRMQRASLVQAKGREY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.45
4 0.55
5 0.6
6 0.66
7 0.72
8 0.76
9 0.82
10 0.9
11 0.91
12 0.88
13 0.86
14 0.83
15 0.82
16 0.79
17 0.74
18 0.68
19 0.61
20 0.53
21 0.45
22 0.39
23 0.28
24 0.22
25 0.18
26 0.14
27 0.16
28 0.18
29 0.18
30 0.24
31 0.26
32 0.26
33 0.28
34 0.31
35 0.29
36 0.28
37 0.28
38 0.23
39 0.26
40 0.25
41 0.23
42 0.23
43 0.23
44 0.24
45 0.25
46 0.24
47 0.23
48 0.26
49 0.28
50 0.33
51 0.34
52 0.37
53 0.4
54 0.4
55 0.38
56 0.38
57 0.43
58 0.39
59 0.37
60 0.34
61 0.33
62 0.35
63 0.36
64 0.36
65 0.29
66 0.26
67 0.24
68 0.21
69 0.17
70 0.14
71 0.11
72 0.07
73 0.06
74 0.05
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.07
82 0.1
83 0.12
84 0.12
85 0.12
86 0.13
87 0.13
88 0.13
89 0.11
90 0.08
91 0.09
92 0.09
93 0.09
94 0.09
95 0.08
96 0.08
97 0.07
98 0.07
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.11
108 0.14
109 0.15
110 0.16
111 0.16
112 0.17
113 0.17
114 0.18
115 0.23
116 0.27
117 0.3
118 0.32
119 0.33
120 0.34
121 0.34
122 0.33
123 0.26
124 0.22
125 0.21
126 0.21
127 0.27
128 0.32
129 0.38
130 0.43
131 0.43
132 0.41
133 0.4
134 0.4
135 0.38
136 0.39
137 0.37
138 0.35