Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TCN4

Protein Details
Accession A0A4Q4TCN4   
Localization Confidence Low
Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
285-306QGPMQTDTRTKRNQRTQFLFFYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 2, nucl 1, mito 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005578  Yif1_fam  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0005793  C:endoplasmic reticulum-Golgi intermediate compartment  
GO:0000139  C:Golgi membrane  
GO:0006888  P:endoplasmic reticulum to Golgi vesicle-mediated transport  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03878  YIF1  
Amino Acid Sequences MQRPIYPQSPPLHHPVPQHVSTVPQLRSPPPPTSSQPQPQGAYGNPYQQGTAGSSSNVFGTYGNFMNDPAAQIGVQLGQNAFKAGQEYLEHNANRWINFSALKHYFNVSNKYVVNKLILVLFPWRHKPWSRKQTVGPNGQEGWYLPPRDDINSPDMYIPVMALVTYILLSTLLAGLRGQFQPELLGYTASKAGVVVVLELLVLKLGSYFLSISNESQLLDLVAYAGYKFVGIIATVALSELVNGGKGTGGWFGWTVFLYTFLANSLFLMRSLRYVLLPESTGNTQGPMQTDTRTKRNQRTQFLFFYSYIVQFLFMWILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.53
4 0.49
5 0.48
6 0.4
7 0.4
8 0.42
9 0.45
10 0.36
11 0.34
12 0.35
13 0.37
14 0.45
15 0.46
16 0.46
17 0.41
18 0.45
19 0.47
20 0.5
21 0.56
22 0.56
23 0.59
24 0.59
25 0.57
26 0.53
27 0.51
28 0.45
29 0.42
30 0.36
31 0.34
32 0.3
33 0.29
34 0.27
35 0.24
36 0.24
37 0.2
38 0.2
39 0.15
40 0.13
41 0.14
42 0.14
43 0.13
44 0.12
45 0.1
46 0.08
47 0.09
48 0.11
49 0.12
50 0.13
51 0.12
52 0.12
53 0.13
54 0.13
55 0.13
56 0.1
57 0.09
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.08
65 0.09
66 0.09
67 0.1
68 0.1
69 0.08
70 0.09
71 0.08
72 0.1
73 0.11
74 0.13
75 0.15
76 0.22
77 0.21
78 0.2
79 0.27
80 0.26
81 0.25
82 0.25
83 0.23
84 0.18
85 0.21
86 0.21
87 0.23
88 0.24
89 0.25
90 0.24
91 0.24
92 0.28
93 0.29
94 0.33
95 0.27
96 0.28
97 0.27
98 0.29
99 0.29
100 0.25
101 0.23
102 0.17
103 0.16
104 0.14
105 0.13
106 0.11
107 0.13
108 0.15
109 0.16
110 0.21
111 0.22
112 0.25
113 0.31
114 0.39
115 0.45
116 0.54
117 0.57
118 0.57
119 0.61
120 0.67
121 0.69
122 0.69
123 0.6
124 0.52
125 0.47
126 0.42
127 0.37
128 0.27
129 0.23
130 0.19
131 0.17
132 0.14
133 0.17
134 0.17
135 0.19
136 0.19
137 0.17
138 0.17
139 0.18
140 0.18
141 0.15
142 0.15
143 0.13
144 0.11
145 0.09
146 0.05
147 0.04
148 0.03
149 0.03
150 0.02
151 0.02
152 0.03
153 0.02
154 0.02
155 0.02
156 0.02
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.07
164 0.07
165 0.08
166 0.07
167 0.07
168 0.08
169 0.08
170 0.09
171 0.07
172 0.08
173 0.07
174 0.08
175 0.09
176 0.08
177 0.07
178 0.06
179 0.05
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.02
190 0.02
191 0.02
192 0.03
193 0.03
194 0.04
195 0.04
196 0.05
197 0.08
198 0.09
199 0.1
200 0.11
201 0.11
202 0.11
203 0.11
204 0.1
205 0.07
206 0.06
207 0.06
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.06
235 0.07
236 0.06
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.09
243 0.08
244 0.1
245 0.1
246 0.1
247 0.09
248 0.09
249 0.1
250 0.08
251 0.09
252 0.1
253 0.09
254 0.09
255 0.11
256 0.11
257 0.12
258 0.14
259 0.14
260 0.13
261 0.14
262 0.15
263 0.16
264 0.16
265 0.15
266 0.17
267 0.18
268 0.2
269 0.18
270 0.18
271 0.16
272 0.18
273 0.19
274 0.19
275 0.19
276 0.21
277 0.29
278 0.33
279 0.41
280 0.49
281 0.56
282 0.64
283 0.73
284 0.79
285 0.81
286 0.83
287 0.81
288 0.77
289 0.74
290 0.67
291 0.57
292 0.51
293 0.43
294 0.36
295 0.3
296 0.24
297 0.19
298 0.15
299 0.16