Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4SRL1

Protein Details
Accession A0A4Q4SRL1    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
6-29EDKNDPWDKEKKHKFQNKSKSEYFHydrophilic
58-80EAYRECKKEWINKRKEERKTAGGBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MPSQTEDKNDPWDKEKKHKFQNKSKSEYFDPCQEAAARSIRCLNRNGGERAMCTDYFEAYRECKKEWINKRKEERKTAGGWIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.66
3 0.65
4 0.71
5 0.77
6 0.81
7 0.83
8 0.88
9 0.86
10 0.83
11 0.78
12 0.74
13 0.69
14 0.66
15 0.58
16 0.54
17 0.48
18 0.4
19 0.37
20 0.31
21 0.27
22 0.23
23 0.26
24 0.19
25 0.16
26 0.22
27 0.23
28 0.25
29 0.26
30 0.26
31 0.25
32 0.3
33 0.31
34 0.28
35 0.27
36 0.25
37 0.27
38 0.27
39 0.21
40 0.19
41 0.17
42 0.15
43 0.15
44 0.16
45 0.14
46 0.15
47 0.21
48 0.21
49 0.23
50 0.27
51 0.32
52 0.41
53 0.5
54 0.58
55 0.62
56 0.7
57 0.79
58 0.83
59 0.87
60 0.87
61 0.83
62 0.79
63 0.74