Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SRW8

Protein Details
Accession A0A4Q4SRW8    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-209LCKTVAPPSRRQRFLKKLGFKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_nucl 11.333, nucl 10, mito_nucl 7.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Pfam View protein in Pfam  
PF13374  TPR_10  
PF13424  TPR_12  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MYQRAVQGKEKALGPEHTSTLDTVNNLGLLYLDQGKLGEAEKMYQRALQGYEKALGPEHTSTLTTVNNLGNLYKVQGKLGEAEKMYQRALQGYEKALGPEPVKTYIPAVNTVYNLGLLFASQSKSDKARAMYLRALVGYQSVFGQDHAHYQKVDEQLKTLEDPENNNPVVLDNDTDQAHVPETSKTTPLCKTVAPPSRRQRFLKKLGFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.33
4 0.3
5 0.28
6 0.26
7 0.24
8 0.21
9 0.17
10 0.15
11 0.14
12 0.12
13 0.11
14 0.1
15 0.08
16 0.07
17 0.08
18 0.1
19 0.09
20 0.09
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.09
27 0.12
28 0.15
29 0.18
30 0.18
31 0.18
32 0.19
33 0.19
34 0.21
35 0.22
36 0.2
37 0.2
38 0.22
39 0.21
40 0.21
41 0.19
42 0.17
43 0.16
44 0.15
45 0.14
46 0.13
47 0.13
48 0.13
49 0.14
50 0.13
51 0.11
52 0.13
53 0.12
54 0.12
55 0.12
56 0.11
57 0.1
58 0.1
59 0.11
60 0.12
61 0.12
62 0.11
63 0.12
64 0.12
65 0.15
66 0.16
67 0.17
68 0.14
69 0.17
70 0.2
71 0.21
72 0.22
73 0.2
74 0.19
75 0.18
76 0.21
77 0.22
78 0.2
79 0.2
80 0.22
81 0.21
82 0.21
83 0.19
84 0.18
85 0.15
86 0.14
87 0.14
88 0.14
89 0.13
90 0.13
91 0.14
92 0.14
93 0.14
94 0.15
95 0.15
96 0.13
97 0.13
98 0.14
99 0.12
100 0.1
101 0.09
102 0.07
103 0.05
104 0.04
105 0.04
106 0.05
107 0.06
108 0.06
109 0.07
110 0.09
111 0.11
112 0.13
113 0.16
114 0.16
115 0.23
116 0.25
117 0.27
118 0.28
119 0.28
120 0.26
121 0.23
122 0.21
123 0.14
124 0.13
125 0.09
126 0.07
127 0.06
128 0.06
129 0.06
130 0.07
131 0.09
132 0.08
133 0.15
134 0.17
135 0.19
136 0.18
137 0.19
138 0.24
139 0.29
140 0.33
141 0.26
142 0.25
143 0.25
144 0.27
145 0.27
146 0.24
147 0.21
148 0.18
149 0.23
150 0.26
151 0.3
152 0.28
153 0.27
154 0.25
155 0.22
156 0.23
157 0.19
158 0.15
159 0.11
160 0.14
161 0.14
162 0.15
163 0.14
164 0.13
165 0.14
166 0.13
167 0.13
168 0.13
169 0.16
170 0.18
171 0.21
172 0.21
173 0.25
174 0.27
175 0.3
176 0.29
177 0.27
178 0.3
179 0.37
180 0.46
181 0.47
182 0.53
183 0.61
184 0.69
185 0.75
186 0.77
187 0.77
188 0.78
189 0.83