Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N2J2

Protein Details
Accession G9N2J2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98GNLLFRRRRNNARRPENEGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 5extr 5cyto_nucl 5, nucl 4.5, cyto 4.5, plas 3, pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPFPQPSLTGPNNVTTLAHAVRGAVEAKHPPSLAHSESNPLDSETIIFIICFVTIFFSSIILIIIVDLIRKSDFTWLGNLLFRRRRNNARRPENEGTAEGIAVITMPANAAVADRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.19
4 0.21
5 0.17
6 0.16
7 0.13
8 0.12
9 0.12
10 0.13
11 0.13
12 0.09
13 0.11
14 0.14
15 0.16
16 0.18
17 0.18
18 0.17
19 0.19
20 0.24
21 0.24
22 0.23
23 0.21
24 0.24
25 0.24
26 0.26
27 0.22
28 0.18
29 0.16
30 0.12
31 0.12
32 0.08
33 0.08
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.04
40 0.03
41 0.04
42 0.05
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.05
59 0.05
60 0.09
61 0.11
62 0.11
63 0.14
64 0.14
65 0.16
66 0.19
67 0.2
68 0.23
69 0.29
70 0.33
71 0.39
72 0.45
73 0.54
74 0.61
75 0.69
76 0.73
77 0.77
78 0.78
79 0.8
80 0.79
81 0.73
82 0.66
83 0.57
84 0.49
85 0.39
86 0.32
87 0.23
88 0.16
89 0.11
90 0.08
91 0.07
92 0.04
93 0.03
94 0.04
95 0.04
96 0.04
97 0.04