FuNGI

A0A4Q4TC85

Protein Details

Accession

A0A4Q4TC85

Localization Confidence

Low

Confidence Score

7.7

NoLS Segment(s)

Position	Sequence	Protein Nature
2-22	KVPQTRSRNRFESKRTPLPLF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, mito_nucl 12, nucl 10, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR023271 Aquaporin-like IPR000425 MIP
Gene Ontology	GO:0016020 C:membrane GO:0015267 F:channel activity
Pfam	View protein in Pfam PF00230 MIP

Amino Acid Sequences

MKVPQTRSRNRFESKRTPLPLFKRFPDTNGTLEYTSGALNRARKRMGLRGEIEVRPNDFRAETLLWSRIRLVFREPFLEFWGAFIMVLLGDSVTAQSYLSNQQYGSWMNICLGWSCAYIFGIYVAGDSGAYLNPAVTLTNCLFRGLSLKRFPTYAAAQFLGTFCAHGLTYANYVSAIDNYEGPGIRTLPPNETASARIFCTFPASFVPKVSQFFSEYIANFTSMFCIFAMRDENGADLKGGGWFVLALFWLNFGLMSSLGWETGSPINPGRDITGRIWLSILGYKGAWSAFNYYSWIPIVVPFIATISGATMYDLFIYTGESPINKPGLGVGHLLSKILGRHDKRGQDEEQGHVDKSTGSSGRTPVSHERDRWSTGNENIIQSGTGADDEVTRKRKGYDKPDGSNQGPQARDIEPENYLQQKTSKDTGYDYDYDGCNKNKEYDNYTGST

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.8
2	0.83
3	0.8
4	0.78
5	0.79
6	0.78
7	0.79
8	0.75
9	0.7
10	0.69
11	0.64
12	0.6
13	0.58
14	0.53
15	0.46
16	0.43
17	0.42
18	0.33
19	0.32
20	0.29
21	0.22
22	0.19
23	0.16
24	0.15
25	0.16
26	0.23
27	0.3
28	0.35
29	0.36
30	0.4
31	0.44
32	0.51
33	0.55
34	0.55
35	0.52
36	0.53
37	0.58
38	0.56
39	0.56
40	0.5
41	0.45
42	0.39
43	0.37
44	0.31
45	0.25
46	0.23
47	0.23
48	0.22
49	0.21
50	0.23
51	0.28
52	0.26
53	0.27
54	0.29
55	0.29
56	0.29
57	0.28
58	0.31
59	0.31
60	0.33
61	0.36
62	0.35
63	0.31
64	0.32
65	0.32
66	0.25
67	0.2
68	0.19
69	0.14
70	0.13
71	0.11
72	0.08
73	0.06
74	0.06
75	0.05
76	0.03
77	0.03
78	0.03
79	0.04
80	0.04
81	0.04
82	0.04
83	0.04
84	0.07
85	0.12
86	0.14
87	0.15
88	0.14
89	0.15
90	0.18
91	0.19
92	0.2
93	0.16
94	0.15
95	0.14
96	0.15
97	0.14
98	0.12
99	0.12
100	0.11
101	0.1
102	0.1
103	0.1
104	0.09
105	0.09
106	0.08
107	0.07
108	0.06
109	0.06
110	0.05
111	0.05
112	0.05
113	0.04
114	0.04
115	0.05
116	0.04
117	0.05
118	0.04
119	0.04
120	0.04
121	0.05
122	0.05
123	0.05
124	0.08
125	0.09
126	0.13
127	0.13
128	0.14
129	0.13
130	0.13
131	0.2
132	0.2
133	0.26
134	0.27
135	0.3
136	0.3
137	0.3
138	0.31
139	0.29
140	0.3
141	0.26
142	0.24
143	0.22
144	0.21
145	0.22
146	0.21
147	0.18
148	0.14
149	0.1
150	0.07
151	0.07
152	0.07
153	0.07
154	0.07
155	0.07
156	0.08
157	0.08
158	0.08
159	0.07
160	0.08
161	0.08
162	0.08
163	0.08
164	0.07
165	0.07
166	0.07
167	0.09
168	0.08
169	0.08
170	0.09
171	0.09
172	0.1
173	0.14
174	0.14
175	0.15
176	0.18
177	0.19
178	0.19
179	0.19
180	0.19
181	0.18
182	0.18
183	0.16
184	0.15
185	0.13
186	0.12
187	0.17
188	0.14
189	0.12
190	0.15
191	0.17
192	0.17
193	0.18
194	0.2
195	0.17
196	0.19
197	0.19
198	0.17
199	0.15
200	0.16
201	0.17
202	0.18
203	0.15
204	0.16
205	0.15
206	0.14
207	0.12
208	0.11
209	0.1
210	0.08
211	0.08
212	0.06
213	0.07
214	0.06
215	0.07
216	0.09
217	0.08
218	0.09
219	0.08
220	0.09
221	0.09
222	0.09
223	0.08
224	0.05
225	0.05
226	0.05
227	0.05
228	0.04
229	0.03
230	0.03
231	0.03
232	0.03
233	0.03
234	0.03
235	0.03
236	0.03
237	0.04
238	0.03
239	0.03
240	0.03
241	0.04
242	0.03
243	0.03
244	0.05
245	0.05
246	0.05
247	0.05
248	0.05
249	0.06
250	0.09
251	0.1
252	0.1
253	0.12
254	0.12
255	0.13
256	0.13
257	0.13
258	0.13
259	0.15
260	0.15
261	0.21
262	0.2
263	0.2
264	0.2
265	0.18
266	0.17
267	0.16
268	0.16
269	0.09
270	0.08
271	0.08
272	0.09
273	0.09
274	0.09
275	0.08
276	0.11
277	0.11
278	0.12
279	0.14
280	0.13
281	0.14
282	0.14
283	0.14
284	0.09
285	0.1
286	0.11
287	0.09
288	0.09
289	0.08
290	0.08
291	0.07
292	0.07
293	0.06
294	0.05
295	0.05
296	0.05
297	0.05
298	0.05
299	0.05
300	0.05
301	0.06
302	0.05
303	0.05
304	0.06
305	0.07
306	0.07
307	0.08
308	0.09
309	0.09
310	0.13
311	0.14
312	0.12
313	0.12
314	0.12
315	0.14
316	0.14
317	0.14
318	0.12
319	0.14
320	0.15
321	0.15
322	0.13
323	0.13
324	0.13
325	0.17
326	0.25
327	0.23
328	0.31
329	0.38
330	0.44
331	0.48
332	0.52
333	0.49
334	0.5
335	0.5
336	0.46
337	0.46
338	0.42
339	0.37
340	0.32
341	0.3
342	0.21
343	0.2
344	0.21
345	0.15
346	0.15
347	0.17
348	0.2
349	0.22
350	0.23
351	0.27
352	0.31
353	0.38
354	0.43
355	0.43
356	0.47
357	0.49
358	0.54
359	0.51
360	0.47
361	0.45
362	0.41
363	0.46
364	0.42
365	0.38
366	0.34
367	0.32
368	0.27
369	0.21
370	0.18
371	0.11
372	0.08
373	0.07
374	0.06
375	0.09
376	0.12
377	0.19
378	0.23
379	0.24
380	0.26
381	0.3
382	0.38
383	0.44
384	0.52
385	0.56
386	0.6
387	0.66
388	0.74
389	0.78
390	0.73
391	0.7
392	0.65
393	0.61
394	0.52
395	0.47
396	0.41
397	0.34
398	0.34
399	0.3
400	0.27
401	0.22
402	0.24
403	0.28
404	0.3
405	0.3
406	0.29
407	0.3
408	0.32
409	0.36
410	0.39
411	0.37
412	0.33
413	0.36
414	0.38
415	0.4
416	0.38
417	0.34
418	0.33
419	0.32
420	0.34
421	0.36
422	0.35
423	0.34
424	0.34
425	0.38
426	0.42
427	0.46
428	0.48
429	0.51

A0A4Q4TC85

3D AlphaFold-predicted Structure Viewer