Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4TN06

Protein Details
Accession A0A4Q4TN06    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-25QNSVSCSRRKSRKAHFSAPSSHydrophilic
NLS Segment(s)
PositionSequence
119-134LERIKAGRELRKKNNK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MTKVQNSVSCSRRKSRKAHFSAPSSVRRVIMSAPLSKELREKYNVRSIPIRKDDEVEIVRGSNKGREGKVISVYRLKYQIHVERVTRDKASGQSVPLGIHPSKVVIKKLKLDKDRENILERIKAGRELRKKNNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.74
3 0.79
4 0.8
5 0.83
6 0.82
7 0.77
8 0.78
9 0.75
10 0.71
11 0.64
12 0.58
13 0.49
14 0.41
15 0.37
16 0.28
17 0.28
18 0.25
19 0.25
20 0.25
21 0.29
22 0.29
23 0.28
24 0.32
25 0.28
26 0.29
27 0.31
28 0.31
29 0.32
30 0.41
31 0.42
32 0.4
33 0.45
34 0.44
35 0.47
36 0.51
37 0.49
38 0.4
39 0.41
40 0.39
41 0.37
42 0.34
43 0.26
44 0.2
45 0.17
46 0.16
47 0.15
48 0.15
49 0.11
50 0.14
51 0.16
52 0.16
53 0.19
54 0.2
55 0.21
56 0.27
57 0.26
58 0.24
59 0.26
60 0.27
61 0.26
62 0.28
63 0.26
64 0.22
65 0.27
66 0.31
67 0.31
68 0.34
69 0.33
70 0.35
71 0.38
72 0.39
73 0.33
74 0.27
75 0.25
76 0.24
77 0.28
78 0.24
79 0.21
80 0.2
81 0.21
82 0.2
83 0.19
84 0.21
85 0.16
86 0.15
87 0.14
88 0.15
89 0.19
90 0.22
91 0.28
92 0.3
93 0.34
94 0.42
95 0.51
96 0.58
97 0.6
98 0.64
99 0.67
100 0.68
101 0.71
102 0.68
103 0.64
104 0.58
105 0.55
106 0.52
107 0.44
108 0.4
109 0.35
110 0.37
111 0.38
112 0.44
113 0.49
114 0.55