Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MH64

Protein Details
Accession G9MH64    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-37SPSKDDSKPIPQRPKKRNPVKKRAKVPKKPKWDAESLBasic
NLS Segment(s)
PositionSequence
9-31PIPQRPKKRNPVKKRAKVPKKPK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
IPR044867  DEUBAD_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13919  ASXH  
PROSITE View protein in PROSITE  
PS51916  DEUBAD  
Amino Acid Sequences SPSKDDSKPIPQRPKKRNPVKKRAKVPKKPKWDAESLLKDPKSPLATANLRSILCNPMAWTALDPEDKAEILALFPDKSHILDSGTEDARPNFASLMNDDSFRYDCAAYTENIAEGRHDPEWLASAWSAHERRKAGDFDKYLVDKLEEEWGVEIPEGMRIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.92
4 0.93
5 0.93
6 0.94
7 0.95
8 0.94
9 0.94
10 0.95
11 0.94
12 0.94
13 0.94
14 0.93
15 0.93
16 0.91
17 0.89
18 0.83
19 0.79
20 0.74
21 0.72
22 0.7
23 0.64
24 0.64
25 0.55
26 0.49
27 0.44
28 0.43
29 0.35
30 0.27
31 0.24
32 0.24
33 0.28
34 0.29
35 0.32
36 0.31
37 0.29
38 0.29
39 0.29
40 0.23
41 0.19
42 0.17
43 0.14
44 0.12
45 0.12
46 0.12
47 0.11
48 0.1
49 0.12
50 0.12
51 0.11
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.06
58 0.05
59 0.06
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.07
68 0.07
69 0.08
70 0.1
71 0.12
72 0.12
73 0.12
74 0.12
75 0.12
76 0.12
77 0.12
78 0.1
79 0.07
80 0.08
81 0.08
82 0.09
83 0.13
84 0.13
85 0.13
86 0.13
87 0.14
88 0.14
89 0.13
90 0.14
91 0.09
92 0.09
93 0.11
94 0.13
95 0.11
96 0.13
97 0.12
98 0.12
99 0.13
100 0.13
101 0.11
102 0.11
103 0.14
104 0.12
105 0.12
106 0.11
107 0.11
108 0.13
109 0.12
110 0.12
111 0.09
112 0.09
113 0.1
114 0.17
115 0.2
116 0.22
117 0.27
118 0.27
119 0.3
120 0.35
121 0.38
122 0.35
123 0.41
124 0.39
125 0.36
126 0.42
127 0.41
128 0.36
129 0.33
130 0.3
131 0.22
132 0.21
133 0.25
134 0.18
135 0.18
136 0.18
137 0.17
138 0.17
139 0.16
140 0.15
141 0.08
142 0.15