Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SSK0

Protein Details
Accession A0A4Q4SSK0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
250-282LDPRLDRQPDNSKKRRSRRRRRRWAMEAQLENCHydrophilic
NLS Segment(s)
PositionSequence
261-272SKKRRSRRRRRR
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010378  TRAPPC13  
Pfam View protein in Pfam  
PF06159  DUF974  
Amino Acid Sequences MSHQRYPSIDPLKEPHSVSLKVLRLSRPSLVTQHPLPSPSTSGAATNAATTAAPMPASLAYNSSGSDANPDPFLLTPILNLPPSFGSAYVGETFSCTLCANHDVPPPPDTPLSATTVASPGGAAPQTPATQRRKYTRDVRIEAEMKTPGSGGTVQKLVLGPVGTDTGEGGDGDGNGDGGTGGTDLEPGQTLQRIVNFDLKEEGNHVLAVTVSYYEATDTSGRTRTFRKLYQFICKGSLIVRTKVSPLLDLDPRLDRQPDNSKKRRSRRRRRRWAMEAQLENCSEDVMQLERVALDVEPGLRHADCNWEVSRSAKPVLHPGEVEQCCFVVEEDGDGEPGEDKDGRIVFGILGIGWRSEMGNKGYLSTGRLGTRVAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.4
4 0.39
5 0.39
6 0.42
7 0.43
8 0.42
9 0.46
10 0.44
11 0.43
12 0.45
13 0.46
14 0.41
15 0.4
16 0.41
17 0.42
18 0.43
19 0.41
20 0.43
21 0.4
22 0.38
23 0.37
24 0.34
25 0.32
26 0.28
27 0.27
28 0.22
29 0.21
30 0.21
31 0.2
32 0.18
33 0.15
34 0.13
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.07
42 0.08
43 0.09
44 0.11
45 0.1
46 0.1
47 0.11
48 0.12
49 0.12
50 0.13
51 0.12
52 0.11
53 0.15
54 0.15
55 0.15
56 0.15
57 0.15
58 0.14
59 0.14
60 0.16
61 0.12
62 0.1
63 0.1
64 0.12
65 0.15
66 0.14
67 0.14
68 0.14
69 0.13
70 0.15
71 0.15
72 0.12
73 0.12
74 0.11
75 0.14
76 0.14
77 0.13
78 0.11
79 0.12
80 0.12
81 0.1
82 0.11
83 0.09
84 0.08
85 0.1
86 0.14
87 0.15
88 0.18
89 0.23
90 0.25
91 0.27
92 0.29
93 0.28
94 0.27
95 0.25
96 0.22
97 0.2
98 0.19
99 0.21
100 0.19
101 0.19
102 0.17
103 0.17
104 0.17
105 0.13
106 0.11
107 0.07
108 0.07
109 0.07
110 0.06
111 0.06
112 0.08
113 0.1
114 0.12
115 0.2
116 0.25
117 0.31
118 0.37
119 0.44
120 0.46
121 0.52
122 0.6
123 0.62
124 0.65
125 0.62
126 0.59
127 0.58
128 0.57
129 0.5
130 0.43
131 0.35
132 0.25
133 0.22
134 0.19
135 0.12
136 0.1
137 0.12
138 0.1
139 0.11
140 0.11
141 0.11
142 0.12
143 0.12
144 0.11
145 0.09
146 0.09
147 0.07
148 0.06
149 0.07
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.02
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.04
175 0.04
176 0.05
177 0.06
178 0.06
179 0.08
180 0.1
181 0.11
182 0.17
183 0.16
184 0.16
185 0.18
186 0.17
187 0.15
188 0.16
189 0.15
190 0.1
191 0.1
192 0.09
193 0.07
194 0.07
195 0.07
196 0.05
197 0.04
198 0.03
199 0.04
200 0.04
201 0.04
202 0.04
203 0.06
204 0.06
205 0.07
206 0.09
207 0.14
208 0.14
209 0.17
210 0.2
211 0.25
212 0.3
213 0.34
214 0.39
215 0.42
216 0.45
217 0.53
218 0.54
219 0.49
220 0.47
221 0.42
222 0.35
223 0.29
224 0.34
225 0.27
226 0.25
227 0.25
228 0.23
229 0.24
230 0.26
231 0.25
232 0.18
233 0.17
234 0.19
235 0.2
236 0.2
237 0.21
238 0.21
239 0.22
240 0.22
241 0.22
242 0.18
243 0.22
244 0.32
245 0.41
246 0.49
247 0.56
248 0.65
249 0.73
250 0.83
251 0.88
252 0.89
253 0.9
254 0.91
255 0.94
256 0.95
257 0.96
258 0.96
259 0.94
260 0.93
261 0.92
262 0.89
263 0.84
264 0.75
265 0.68
266 0.57
267 0.48
268 0.37
269 0.27
270 0.18
271 0.12
272 0.11
273 0.08
274 0.08
275 0.08
276 0.08
277 0.08
278 0.08
279 0.09
280 0.07
281 0.06
282 0.06
283 0.07
284 0.07
285 0.08
286 0.1
287 0.1
288 0.1
289 0.1
290 0.17
291 0.17
292 0.22
293 0.22
294 0.22
295 0.23
296 0.25
297 0.29
298 0.24
299 0.27
300 0.25
301 0.25
302 0.33
303 0.37
304 0.37
305 0.33
306 0.32
307 0.39
308 0.37
309 0.37
310 0.28
311 0.24
312 0.21
313 0.21
314 0.19
315 0.11
316 0.1
317 0.1
318 0.11
319 0.11
320 0.11
321 0.1
322 0.1
323 0.09
324 0.09
325 0.11
326 0.1
327 0.1
328 0.15
329 0.15
330 0.16
331 0.15
332 0.16
333 0.13
334 0.13
335 0.13
336 0.08
337 0.09
338 0.09
339 0.08
340 0.08
341 0.08
342 0.08
343 0.1
344 0.15
345 0.16
346 0.21
347 0.21
348 0.23
349 0.25
350 0.26
351 0.26
352 0.26
353 0.27
354 0.24
355 0.24