Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SUG1

Protein Details
Accession A0A4Q4SUG1    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-114HPDKLYSSRKRRVKRLKQSGNCTDDHydrophilic
130-150QQKPRGQGLKQPPKPKRNDSSHydrophilic
NLS Segment(s)
PositionSequence
98-104RKRRVKR
134-146RGQGLKQPPKPKR
160-181SARRGPGSESGAEKGEKKGGKK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASSEQSHVNYRDYPSGEDRRAQQKFQRNKGRSSDVKSMSLPYENYIGAVLNRKYRITLLCTNKDHLDIYSVTSWDGESFEAQAFNLSRHPDKLYSSRKRRVKRLKQSGNCTDDFEQGHSRYLISPAPPQQKPRGQGLKQPPKPKRNDSSEPQFPGLGPSARRGPGSESGAEKGEKKGGKKQCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.45
4 0.44
5 0.44
6 0.47
7 0.52
8 0.53
9 0.54
10 0.54
11 0.56
12 0.63
13 0.7
14 0.75
15 0.68
16 0.72
17 0.75
18 0.76
19 0.72
20 0.69
21 0.69
22 0.61
23 0.6
24 0.54
25 0.49
26 0.42
27 0.38
28 0.31
29 0.22
30 0.21
31 0.17
32 0.16
33 0.14
34 0.12
35 0.11
36 0.17
37 0.17
38 0.2
39 0.21
40 0.21
41 0.22
42 0.24
43 0.25
44 0.25
45 0.32
46 0.35
47 0.42
48 0.44
49 0.45
50 0.44
51 0.43
52 0.37
53 0.28
54 0.23
55 0.15
56 0.15
57 0.14
58 0.14
59 0.12
60 0.12
61 0.11
62 0.09
63 0.09
64 0.07
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.08
71 0.07
72 0.07
73 0.1
74 0.11
75 0.11
76 0.13
77 0.15
78 0.14
79 0.17
80 0.25
81 0.33
82 0.41
83 0.49
84 0.57
85 0.63
86 0.68
87 0.76
88 0.79
89 0.8
90 0.81
91 0.83
92 0.85
93 0.85
94 0.88
95 0.85
96 0.79
97 0.69
98 0.61
99 0.52
100 0.44
101 0.37
102 0.31
103 0.27
104 0.23
105 0.24
106 0.2
107 0.19
108 0.16
109 0.17
110 0.16
111 0.14
112 0.18
113 0.24
114 0.32
115 0.34
116 0.38
117 0.44
118 0.48
119 0.49
120 0.54
121 0.56
122 0.5
123 0.57
124 0.64
125 0.67
126 0.68
127 0.76
128 0.75
129 0.74
130 0.81
131 0.81
132 0.79
133 0.77
134 0.78
135 0.76
136 0.76
137 0.76
138 0.72
139 0.65
140 0.56
141 0.46
142 0.42
143 0.37
144 0.31
145 0.24
146 0.24
147 0.27
148 0.29
149 0.29
150 0.27
151 0.29
152 0.32
153 0.35
154 0.34
155 0.32
156 0.32
157 0.35
158 0.35
159 0.31
160 0.27
161 0.3
162 0.31
163 0.32
164 0.4