Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4TQ87

Protein Details
Accession A0A4Q4TQ87    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNIPKTRKTYCRGRDCKKHTLHKVTQYKAHydrophilic
72-93LECSSCKTKKQLPLKRCKHFELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTYCRGRDCKKHTLHKVTQYKAGKASAFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECSSCKTKKQLPLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.84
4 0.87
5 0.85
6 0.86
7 0.84
8 0.84
9 0.82
10 0.82
11 0.83
12 0.76
13 0.75
14 0.69
15 0.62
16 0.55
17 0.5
18 0.39
19 0.32
20 0.31
21 0.3
22 0.3
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.48
63 0.44
64 0.42
65 0.43
66 0.46
67 0.5
68 0.58
69 0.63
70 0.66
71 0.75
72 0.8
73 0.84
74 0.83
75 0.79
76 0.74
77 0.69
78 0.66
79 0.65
80 0.64
81 0.62
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42