Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4SVB7

Protein Details
Accession A0A4Q4SVB7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-74HYATMKPEQKKAKKNDKKPGKPPAQRBasic
NLS Segment(s)
PositionSequence
56-74EQKKAKKNDKKPGKPPAQR
Subcellular Location(s) E.R. 7, plas 6, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGQFGFMSRLGATDEAVAVLNDQPFIFTVLVVALVACISQCVLIWYIHYATMKPEQKKAKKNDKKPGKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.08
6 0.07
7 0.08
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.09
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.03
22 0.03
23 0.03
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.05
31 0.05
32 0.06
33 0.08
34 0.08
35 0.11
36 0.11
37 0.1
38 0.12
39 0.21
40 0.28
41 0.29
42 0.36
43 0.45
44 0.53
45 0.63
46 0.7
47 0.73
48 0.76
49 0.84
50 0.88
51 0.89
52 0.91
53 0.91
54 0.92