Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N9U0

Protein Details
Accession G9N9U0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60MTFVCKKCKKAFRKDAQEFDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008913  Znf_CHY  
IPR037274  Znf_CHY_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF05495  zf-CHY  
PROSITE View protein in PROSITE  
PS51266  ZF_CHY  
Amino Acid Sequences MCKHILNAQVSIRSPCCRKWFDCAECHAEQESHPLLQSFEMTFVCKKCKKAFRKDAQEFDESDEYCPHCDNHFVLEAKTPKAALTIEGEDVRMNNKLLKDERVRQDGRRTIFDPTPDADKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.43
4 0.44
5 0.45
6 0.49
7 0.56
8 0.56
9 0.58
10 0.57
11 0.56
12 0.51
13 0.5
14 0.43
15 0.34
16 0.28
17 0.28
18 0.24
19 0.17
20 0.17
21 0.15
22 0.14
23 0.14
24 0.15
25 0.09
26 0.09
27 0.09
28 0.11
29 0.13
30 0.14
31 0.21
32 0.23
33 0.27
34 0.34
35 0.43
36 0.5
37 0.59
38 0.69
39 0.71
40 0.79
41 0.81
42 0.8
43 0.74
44 0.67
45 0.56
46 0.49
47 0.42
48 0.31
49 0.25
50 0.2
51 0.16
52 0.15
53 0.15
54 0.12
55 0.1
56 0.11
57 0.11
58 0.12
59 0.16
60 0.16
61 0.16
62 0.21
63 0.22
64 0.22
65 0.22
66 0.19
67 0.15
68 0.15
69 0.15
70 0.11
71 0.12
72 0.13
73 0.14
74 0.15
75 0.15
76 0.14
77 0.14
78 0.14
79 0.12
80 0.12
81 0.13
82 0.14
83 0.19
84 0.22
85 0.29
86 0.35
87 0.42
88 0.49
89 0.55
90 0.57
91 0.57
92 0.64
93 0.64
94 0.61
95 0.58
96 0.52
97 0.5
98 0.5
99 0.48
100 0.41
101 0.37
102 0.38