Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4W5Z2

Protein Details
Accession A0A4Q4W5Z2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33LNPSAIIESRTRRRKRKKPPSASTNYRLAPHydrophilic
199-220FELSKFKKRHFKVPKWKDLKEYBasic
NLS Segment(s)
PositionSequence
13-23RTRRRKRKKPP
207-207R
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MDFLNPSAIIESRTRRRKRKKPPSASTNYRLAPEKRNTYPTAFNAVFTAAIRPERLHRKDLPAAPKNWKEAIQHRYAEDWKAAAQRKWDQIYRVFTYKFNKNGFLQKFKAKLVVRGNLQPRKKLNAYVSTLAGRSFRMLMAVAARFNLDLRQLDAVNAFLHSNIDELVYFLKMRILRDRKAKKLWLMQDTYWEKIYSRFELSKFKKRHFKVPKWKDLKEYEGEAPAASKKLYLEKVGSLLYKAVTTRPDIAKAASHLSRYSKNPSPIHLDAVNKALLHGYHTRYLAIQYGKDEKPNGFLISLFGGPIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.75
4 0.83
5 0.89
6 0.92
7 0.93
8 0.94
9 0.95
10 0.95
11 0.94
12 0.93
13 0.87
14 0.84
15 0.75
16 0.67
17 0.64
18 0.57
19 0.56
20 0.55
21 0.57
22 0.54
23 0.58
24 0.58
25 0.56
26 0.58
27 0.52
28 0.52
29 0.44
30 0.39
31 0.34
32 0.31
33 0.26
34 0.2
35 0.19
36 0.12
37 0.14
38 0.14
39 0.15
40 0.22
41 0.32
42 0.36
43 0.4
44 0.42
45 0.48
46 0.56
47 0.62
48 0.64
49 0.61
50 0.62
51 0.65
52 0.65
53 0.62
54 0.56
55 0.53
56 0.48
57 0.49
58 0.5
59 0.48
60 0.46
61 0.42
62 0.45
63 0.43
64 0.39
65 0.32
66 0.26
67 0.21
68 0.27
69 0.3
70 0.27
71 0.31
72 0.35
73 0.41
74 0.45
75 0.46
76 0.42
77 0.43
78 0.48
79 0.46
80 0.45
81 0.4
82 0.39
83 0.42
84 0.45
85 0.46
86 0.41
87 0.41
88 0.39
89 0.47
90 0.48
91 0.49
92 0.46
93 0.45
94 0.46
95 0.43
96 0.47
97 0.39
98 0.41
99 0.41
100 0.43
101 0.39
102 0.43
103 0.51
104 0.51
105 0.52
106 0.51
107 0.47
108 0.48
109 0.47
110 0.46
111 0.42
112 0.42
113 0.44
114 0.39
115 0.38
116 0.32
117 0.31
118 0.26
119 0.22
120 0.14
121 0.11
122 0.09
123 0.08
124 0.07
125 0.07
126 0.07
127 0.08
128 0.09
129 0.08
130 0.08
131 0.08
132 0.07
133 0.07
134 0.08
135 0.07
136 0.06
137 0.07
138 0.09
139 0.09
140 0.09
141 0.09
142 0.09
143 0.07
144 0.08
145 0.07
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.05
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.08
159 0.09
160 0.11
161 0.2
162 0.25
163 0.29
164 0.4
165 0.47
166 0.51
167 0.56
168 0.59
169 0.55
170 0.58
171 0.6
172 0.57
173 0.53
174 0.46
175 0.49
176 0.47
177 0.43
178 0.36
179 0.3
180 0.24
181 0.24
182 0.27
183 0.2
184 0.22
185 0.23
186 0.24
187 0.35
188 0.41
189 0.46
190 0.48
191 0.53
192 0.58
193 0.58
194 0.67
195 0.68
196 0.72
197 0.74
198 0.8
199 0.83
200 0.82
201 0.82
202 0.78
203 0.72
204 0.67
205 0.59
206 0.52
207 0.44
208 0.38
209 0.35
210 0.27
211 0.24
212 0.19
213 0.17
214 0.12
215 0.11
216 0.1
217 0.16
218 0.18
219 0.2
220 0.2
221 0.2
222 0.23
223 0.24
224 0.23
225 0.18
226 0.16
227 0.14
228 0.14
229 0.13
230 0.13
231 0.13
232 0.16
233 0.21
234 0.23
235 0.26
236 0.25
237 0.26
238 0.26
239 0.27
240 0.3
241 0.26
242 0.25
243 0.25
244 0.29
245 0.33
246 0.34
247 0.4
248 0.41
249 0.48
250 0.49
251 0.5
252 0.54
253 0.5
254 0.51
255 0.48
256 0.43
257 0.36
258 0.37
259 0.34
260 0.25
261 0.24
262 0.2
263 0.16
264 0.18
265 0.22
266 0.23
267 0.26
268 0.26
269 0.27
270 0.26
271 0.27
272 0.29
273 0.27
274 0.25
275 0.25
276 0.32
277 0.33
278 0.37
279 0.39
280 0.34
281 0.35
282 0.37
283 0.33
284 0.26
285 0.25
286 0.22
287 0.22
288 0.21