Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4WSR5

Protein Details
Accession A0A4Q4WSR5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPNHRRRSTLEMQKRTREERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 7.5, cyto_mito 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019236  APP1_cat  
Gene Ontology GO:0008195  F:phosphatidate phosphatase activity  
Pfam View protein in Pfam  
PF09949  APP1_cat  
Amino Acid Sequences MAPNHRRRSTLEMQKRTREERGFDRTESDLSSTDFSSAISAKLSPSDKFYDAFSYLGKKNPFSRTVTSQDTVWLLDNTAYRNQTSGKWEAEYVAAVFSQHSFGVISDAVSMIAKQIGLDERDPNWPTVEERTKLFTQTIKPATTVKALYRNAVPLKLGPGGRNGISSDIKKLPGIENGELLAPTVAHVPKGVNGILEMRTFYAEPEGWAVISDVDDTIKITQTSDPIGILRTTFVDAPSVCPGMPELYWHIQSAIKDTSPWFYLSASPYNLYPFLRDFREEYYPHGTIILRDSSWMSIPGLLSSLTLGTEEYKVDRMEKIHSWLPRRKMILIGDSTQSDPESYGEIYRTYPDWVKVILIRKVEDIAAIGIDSKNQPERFQEAFEGVPKDVWHVFTDPAECTKIIDNAVASAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.8
4 0.79
5 0.73
6 0.69
7 0.68
8 0.69
9 0.65
10 0.59
11 0.56
12 0.49
13 0.45
14 0.4
15 0.33
16 0.25
17 0.22
18 0.23
19 0.2
20 0.18
21 0.16
22 0.14
23 0.14
24 0.13
25 0.12
26 0.11
27 0.11
28 0.11
29 0.17
30 0.2
31 0.18
32 0.22
33 0.26
34 0.27
35 0.27
36 0.28
37 0.27
38 0.26
39 0.26
40 0.23
41 0.25
42 0.25
43 0.31
44 0.32
45 0.31
46 0.37
47 0.43
48 0.46
49 0.45
50 0.49
51 0.49
52 0.53
53 0.55
54 0.49
55 0.43
56 0.4
57 0.36
58 0.31
59 0.26
60 0.2
61 0.14
62 0.15
63 0.17
64 0.17
65 0.21
66 0.21
67 0.19
68 0.21
69 0.22
70 0.23
71 0.27
72 0.29
73 0.26
74 0.26
75 0.26
76 0.25
77 0.24
78 0.21
79 0.16
80 0.12
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.07
90 0.09
91 0.09
92 0.08
93 0.07
94 0.08
95 0.07
96 0.07
97 0.07
98 0.05
99 0.06
100 0.05
101 0.05
102 0.07
103 0.09
104 0.11
105 0.13
106 0.16
107 0.17
108 0.23
109 0.25
110 0.24
111 0.22
112 0.21
113 0.21
114 0.26
115 0.31
116 0.26
117 0.26
118 0.31
119 0.31
120 0.31
121 0.31
122 0.27
123 0.25
124 0.32
125 0.35
126 0.3
127 0.31
128 0.31
129 0.31
130 0.3
131 0.28
132 0.23
133 0.27
134 0.27
135 0.28
136 0.27
137 0.3
138 0.29
139 0.27
140 0.25
141 0.17
142 0.19
143 0.21
144 0.21
145 0.16
146 0.18
147 0.19
148 0.18
149 0.18
150 0.16
151 0.16
152 0.18
153 0.18
154 0.19
155 0.19
156 0.2
157 0.19
158 0.2
159 0.18
160 0.2
161 0.23
162 0.19
163 0.18
164 0.17
165 0.17
166 0.16
167 0.14
168 0.09
169 0.05
170 0.05
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.09
177 0.11
178 0.11
179 0.08
180 0.08
181 0.1
182 0.11
183 0.11
184 0.09
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.07
191 0.07
192 0.08
193 0.08
194 0.07
195 0.07
196 0.07
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.06
206 0.06
207 0.06
208 0.07
209 0.08
210 0.09
211 0.09
212 0.09
213 0.08
214 0.09
215 0.08
216 0.08
217 0.07
218 0.07
219 0.07
220 0.08
221 0.07
222 0.09
223 0.09
224 0.11
225 0.12
226 0.12
227 0.11
228 0.11
229 0.11
230 0.1
231 0.1
232 0.09
233 0.11
234 0.13
235 0.15
236 0.15
237 0.15
238 0.16
239 0.16
240 0.19
241 0.16
242 0.14
243 0.14
244 0.15
245 0.16
246 0.15
247 0.16
248 0.12
249 0.11
250 0.14
251 0.17
252 0.19
253 0.18
254 0.18
255 0.17
256 0.18
257 0.19
258 0.16
259 0.15
260 0.14
261 0.16
262 0.18
263 0.19
264 0.19
265 0.21
266 0.27
267 0.26
268 0.28
269 0.31
270 0.3
271 0.28
272 0.28
273 0.24
274 0.19
275 0.22
276 0.2
277 0.13
278 0.13
279 0.14
280 0.13
281 0.14
282 0.14
283 0.11
284 0.1
285 0.11
286 0.1
287 0.1
288 0.09
289 0.08
290 0.07
291 0.07
292 0.05
293 0.05
294 0.06
295 0.06
296 0.07
297 0.08
298 0.09
299 0.11
300 0.12
301 0.14
302 0.16
303 0.16
304 0.2
305 0.22
306 0.26
307 0.28
308 0.33
309 0.4
310 0.46
311 0.5
312 0.52
313 0.53
314 0.49
315 0.49
316 0.48
317 0.47
318 0.43
319 0.39
320 0.35
321 0.33
322 0.32
323 0.27
324 0.24
325 0.17
326 0.14
327 0.12
328 0.12
329 0.11
330 0.12
331 0.12
332 0.13
333 0.14
334 0.15
335 0.15
336 0.17
337 0.2
338 0.2
339 0.21
340 0.21
341 0.22
342 0.25
343 0.32
344 0.33
345 0.32
346 0.32
347 0.31
348 0.32
349 0.29
350 0.25
351 0.18
352 0.14
353 0.11
354 0.1
355 0.1
356 0.08
357 0.11
358 0.11
359 0.14
360 0.22
361 0.23
362 0.25
363 0.28
364 0.35
365 0.35
366 0.37
367 0.35
368 0.3
369 0.31
370 0.34
371 0.32
372 0.26
373 0.26
374 0.22
375 0.24
376 0.23
377 0.23
378 0.21
379 0.2
380 0.22
381 0.23
382 0.26
383 0.24
384 0.25
385 0.26
386 0.23
387 0.23
388 0.24
389 0.24
390 0.23
391 0.23
392 0.2