Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WUD2

Protein Details
Accession A0A4Q4WUD2    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-80ATPYQQHRKGRRRGSRTQRAPNNHNNEHydrophilic
NLS Segment(s)
PositionSequence
61-67RKGRRRG
Subcellular Location(s) nucl 15, cyto 7, mito 4
Family & Domain DBs
Amino Acid Sequences MKLLTTYGWTQSVGTSRYEGEDSPVRSLLLQSHLVRQNDSDDDRKPGATEPLNATPYQQHRKGRRRGSRTQRAPNNHNNEHGLYRGMATEDIRYLSPERYERGIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.19
5 0.2
6 0.18
7 0.18
8 0.22
9 0.23
10 0.24
11 0.24
12 0.22
13 0.21
14 0.21
15 0.19
16 0.17
17 0.2
18 0.19
19 0.25
20 0.31
21 0.31
22 0.31
23 0.29
24 0.28
25 0.26
26 0.28
27 0.24
28 0.19
29 0.23
30 0.23
31 0.23
32 0.2
33 0.18
34 0.2
35 0.18
36 0.19
37 0.19
38 0.22
39 0.23
40 0.22
41 0.22
42 0.22
43 0.27
44 0.31
45 0.33
46 0.36
47 0.46
48 0.55
49 0.64
50 0.7
51 0.74
52 0.75
53 0.8
54 0.83
55 0.84
56 0.84
57 0.85
58 0.83
59 0.82
60 0.81
61 0.81
62 0.79
63 0.71
64 0.65
65 0.58
66 0.51
67 0.45
68 0.38
69 0.3
70 0.21
71 0.18
72 0.15
73 0.13
74 0.12
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.15
81 0.16
82 0.18
83 0.23
84 0.25
85 0.27