Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4VQA8

Protein Details
Accession A0A4Q4VQA8   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-41GGTLKLKGAKVQKSKKKKKDKPSNNLERSLSHydrophilic
56-77SSSSKEVEKKEKKKRRDDSDGGBasic
NLS Segment(s)
PositionSequence
15-32KLKGAKVQKSKKKKKDKP
64-71KKEKKKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGAGDYAVAAGGTLKLKGAKVQKSKKKKKDKPSNNLERSLSVMEGDDDPKATSSSSSSSKEVEKKEKKKRRDDSDGGAEDPENPDHDTVEYKTEAERRHEEIQRRKLLKMFEDGSAKPELLKTHKERVEGLNTYLSKLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.11
4 0.17
5 0.25
6 0.32
7 0.42
8 0.53
9 0.62
10 0.72
11 0.82
12 0.87
13 0.91
14 0.91
15 0.92
16 0.93
17 0.94
18 0.93
19 0.93
20 0.94
21 0.89
22 0.85
23 0.75
24 0.64
25 0.56
26 0.46
27 0.35
28 0.24
29 0.18
30 0.13
31 0.13
32 0.13
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.08
39 0.07
40 0.08
41 0.11
42 0.15
43 0.17
44 0.18
45 0.19
46 0.23
47 0.28
48 0.32
49 0.39
50 0.45
51 0.53
52 0.63
53 0.7
54 0.75
55 0.8
56 0.85
57 0.83
58 0.83
59 0.77
60 0.72
61 0.72
62 0.64
63 0.54
64 0.44
65 0.35
66 0.26
67 0.23
68 0.16
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.1
75 0.1
76 0.12
77 0.11
78 0.11
79 0.13
80 0.17
81 0.19
82 0.23
83 0.26
84 0.28
85 0.35
86 0.41
87 0.48
88 0.53
89 0.6
90 0.64
91 0.63
92 0.59
93 0.56
94 0.54
95 0.48
96 0.45
97 0.37
98 0.32
99 0.34
100 0.33
101 0.32
102 0.29
103 0.26
104 0.2
105 0.2
106 0.2
107 0.2
108 0.29
109 0.32
110 0.4
111 0.43
112 0.45
113 0.46
114 0.48
115 0.51
116 0.45
117 0.42
118 0.4
119 0.37
120 0.37
121 0.35
122 0.3
123 0.23
124 0.21
125 0.22
126 0.22
127 0.24
128 0.29
129 0.33
130 0.34