Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WXG6

Protein Details
Accession A0A4Q4WXG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-114ANGGRGRDERRRSRHRSEKPRRRRYADLGMPBasic
NLS Segment(s)
PositionSequence
88-107RGRDERRRSRHRSEKPRRRR
Subcellular Location(s) plas 14, extr 6, mito 4, E.R. 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MALTVPTCRKYKQTFPGTLVWYGLLVALCYLFASAARNAQKALAYSGKALGITLSMNLCHWFPVASVVAALVLWLAQAADDGYANGGRGRDERRRSRHRSEKPRRRRYADLGMPDPGMPDPWDESPPQYVERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.67
4 0.62
5 0.56
6 0.47
7 0.37
8 0.27
9 0.21
10 0.18
11 0.1
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.05
18 0.03
19 0.04
20 0.06
21 0.07
22 0.13
23 0.16
24 0.16
25 0.17
26 0.18
27 0.19
28 0.17
29 0.2
30 0.16
31 0.15
32 0.15
33 0.16
34 0.15
35 0.14
36 0.13
37 0.09
38 0.06
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.05
50 0.07
51 0.08
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.05
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.03
69 0.04
70 0.04
71 0.04
72 0.05
73 0.06
74 0.06
75 0.09
76 0.15
77 0.23
78 0.32
79 0.42
80 0.51
81 0.61
82 0.68
83 0.76
84 0.81
85 0.84
86 0.87
87 0.89
88 0.9
89 0.91
90 0.94
91 0.93
92 0.9
93 0.87
94 0.84
95 0.83
96 0.8
97 0.76
98 0.68
99 0.61
100 0.54
101 0.46
102 0.38
103 0.28
104 0.21
105 0.14
106 0.13
107 0.14
108 0.16
109 0.18
110 0.18
111 0.21
112 0.24
113 0.26