Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R3Q1

Protein Details
Accession C4R3Q1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-28KALNKRSESKHTAKRVNRQRVLLHydrophilic
47-67SLLPHAKKEPKLDHKKRLYELBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR026532  BRX1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0008097  F:5S rRNA binding  
GO:0042134  F:rRNA primary transcript binding  
GO:0000464  P:endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000465  P:exonucleolytic trimming to generate mature 5'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000027  P:ribosomal large subunit assembly  
KEGG ppa:PAS_chr3_0160  -  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MSAIYKALNKRSESKHTAKRVNRQRVLLMTSRGVTYRHRHLVQDLFSLLPHAKKEPKLDHKKRLYELNEIAELYNCNNVMYFEAKKHQDLYLWISKPPNGPSLKFHVQNMHTLDELNFTGNCLKGSRPILSFDKAFDDGEAQFQLMKELFIHVFGVPPLARKSKPFIDHVMSFSIVDGKVWIRNFQIAETEELKENEEAATIDDSILKDLTLVEIGPRVVLTLITVLEGSFGGPKIYENKEYVSPNVVRAQQKQLEAEAAANRSKATLDRKIKIRDQVLEADPLDNEVLFKNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.73
4 0.79
5 0.79
6 0.82
7 0.84
8 0.86
9 0.83
10 0.78
11 0.74
12 0.69
13 0.66
14 0.61
15 0.54
16 0.46
17 0.41
18 0.38
19 0.33
20 0.29
21 0.29
22 0.3
23 0.36
24 0.41
25 0.42
26 0.43
27 0.47
28 0.52
29 0.49
30 0.46
31 0.38
32 0.3
33 0.27
34 0.28
35 0.24
36 0.19
37 0.18
38 0.19
39 0.24
40 0.28
41 0.37
42 0.45
43 0.54
44 0.63
45 0.71
46 0.77
47 0.8
48 0.83
49 0.79
50 0.78
51 0.71
52 0.68
53 0.62
54 0.56
55 0.48
56 0.4
57 0.37
58 0.28
59 0.25
60 0.18
61 0.16
62 0.12
63 0.1
64 0.1
65 0.1
66 0.1
67 0.13
68 0.14
69 0.14
70 0.2
71 0.22
72 0.24
73 0.25
74 0.24
75 0.23
76 0.24
77 0.28
78 0.3
79 0.29
80 0.3
81 0.29
82 0.31
83 0.32
84 0.32
85 0.32
86 0.26
87 0.27
88 0.28
89 0.35
90 0.39
91 0.37
92 0.37
93 0.36
94 0.35
95 0.39
96 0.38
97 0.31
98 0.25
99 0.24
100 0.22
101 0.18
102 0.17
103 0.12
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.09
110 0.09
111 0.13
112 0.15
113 0.17
114 0.17
115 0.21
116 0.23
117 0.25
118 0.25
119 0.21
120 0.21
121 0.2
122 0.18
123 0.14
124 0.13
125 0.11
126 0.12
127 0.11
128 0.08
129 0.07
130 0.07
131 0.08
132 0.06
133 0.06
134 0.05
135 0.06
136 0.06
137 0.06
138 0.07
139 0.06
140 0.06
141 0.06
142 0.08
143 0.06
144 0.08
145 0.11
146 0.13
147 0.14
148 0.15
149 0.2
150 0.25
151 0.28
152 0.29
153 0.31
154 0.33
155 0.34
156 0.34
157 0.3
158 0.25
159 0.21
160 0.18
161 0.16
162 0.11
163 0.09
164 0.08
165 0.08
166 0.11
167 0.11
168 0.13
169 0.11
170 0.15
171 0.15
172 0.14
173 0.17
174 0.15
175 0.18
176 0.19
177 0.19
178 0.18
179 0.18
180 0.2
181 0.16
182 0.15
183 0.11
184 0.1
185 0.09
186 0.08
187 0.09
188 0.07
189 0.07
190 0.09
191 0.09
192 0.09
193 0.09
194 0.07
195 0.07
196 0.06
197 0.07
198 0.06
199 0.05
200 0.05
201 0.06
202 0.07
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.05
210 0.06
211 0.06
212 0.06
213 0.05
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.08
222 0.13
223 0.17
224 0.21
225 0.21
226 0.24
227 0.29
228 0.31
229 0.31
230 0.32
231 0.29
232 0.29
233 0.33
234 0.37
235 0.36
236 0.38
237 0.45
238 0.43
239 0.45
240 0.44
241 0.4
242 0.35
243 0.31
244 0.3
245 0.26
246 0.24
247 0.22
248 0.21
249 0.2
250 0.18
251 0.18
252 0.21
253 0.24
254 0.32
255 0.39
256 0.46
257 0.55
258 0.62
259 0.67
260 0.7
261 0.69
262 0.65
263 0.61
264 0.6
265 0.54
266 0.52
267 0.46
268 0.39
269 0.32
270 0.28
271 0.24
272 0.16
273 0.15