Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XN67

Protein Details
Accession A0A4V1XN67    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-145ETPRNWTKVTHQKKKKKESKTEDSTPRDNHydrophilic
NLS Segment(s)
PositionSequence
129-133KKKKK
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPRLVAPDLGPGKLLAAALDQSLTLIPKDGAHQKLSQALEQQLLATIRGAVATDYAQPRPTTPPPAYQPTPAIMAKAIGPEDYTSPPFQHAGKEDKTDKKPTPTKKVSWADESDKGETPRNWTKVTHQKKKKKESKTEDSTPRDNRIFLRLAQEDNLRGVTPTELRLPLAELLGCGLDTITRAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.09
3 0.08
4 0.09
5 0.08
6 0.08
7 0.07
8 0.07
9 0.08
10 0.08
11 0.07
12 0.08
13 0.08
14 0.09
15 0.13
16 0.2
17 0.23
18 0.25
19 0.26
20 0.27
21 0.33
22 0.34
23 0.31
24 0.28
25 0.26
26 0.25
27 0.23
28 0.21
29 0.18
30 0.16
31 0.15
32 0.11
33 0.09
34 0.08
35 0.08
36 0.08
37 0.05
38 0.05
39 0.06
40 0.1
41 0.12
42 0.13
43 0.15
44 0.15
45 0.17
46 0.22
47 0.25
48 0.27
49 0.27
50 0.33
51 0.36
52 0.43
53 0.43
54 0.39
55 0.37
56 0.32
57 0.34
58 0.27
59 0.23
60 0.15
61 0.14
62 0.12
63 0.12
64 0.11
65 0.07
66 0.07
67 0.07
68 0.09
69 0.1
70 0.11
71 0.11
72 0.11
73 0.12
74 0.13
75 0.13
76 0.13
77 0.14
78 0.18
79 0.19
80 0.23
81 0.27
82 0.33
83 0.37
84 0.42
85 0.41
86 0.45
87 0.51
88 0.54
89 0.59
90 0.58
91 0.57
92 0.61
93 0.65
94 0.6
95 0.57
96 0.54
97 0.48
98 0.48
99 0.48
100 0.4
101 0.36
102 0.34
103 0.34
104 0.3
105 0.32
106 0.34
107 0.35
108 0.34
109 0.32
110 0.4
111 0.46
112 0.56
113 0.6
114 0.62
115 0.69
116 0.78
117 0.88
118 0.88
119 0.88
120 0.88
121 0.87
122 0.87
123 0.86
124 0.86
125 0.84
126 0.82
127 0.8
128 0.73
129 0.7
130 0.61
131 0.54
132 0.47
133 0.42
134 0.38
135 0.32
136 0.34
137 0.3
138 0.3
139 0.31
140 0.32
141 0.28
142 0.27
143 0.26
144 0.19
145 0.17
146 0.16
147 0.16
148 0.15
149 0.16
150 0.18
151 0.18
152 0.18
153 0.19
154 0.2
155 0.18
156 0.18
157 0.16
158 0.11
159 0.11
160 0.11
161 0.1
162 0.08
163 0.07
164 0.06