Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WY74

Protein Details
Accession A0A4Q4WY74    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-40IEICRRKDAKSARIKKNTKSSQTKFKVRCHydrophilic
88-107VTDLQIKEVPKKNKKGKHTAHydrophilic
NLS Segment(s)
PositionSequence
23-26ARIK
98-105KKNKKGKH
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIGDIKKFIEICRRKDAKSARIKKNTKSSQTKFKVRCSKHLYTLVLKDSDKAEKLKQSLPPSTHPPHIGPYHGTSGPPVTDPDPVTDLQIKEVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.48
3 0.52
4 0.49
5 0.57
6 0.63
7 0.62
8 0.66
9 0.7
10 0.7
11 0.76
12 0.81
13 0.8
14 0.82
15 0.81
16 0.8
17 0.8
18 0.75
19 0.75
20 0.78
21 0.8
22 0.74
23 0.75
24 0.75
25 0.67
26 0.72
27 0.69
28 0.66
29 0.63
30 0.64
31 0.57
32 0.51
33 0.51
34 0.43
35 0.37
36 0.32
37 0.27
38 0.22
39 0.21
40 0.19
41 0.17
42 0.17
43 0.18
44 0.21
45 0.24
46 0.28
47 0.31
48 0.34
49 0.35
50 0.37
51 0.41
52 0.42
53 0.41
54 0.37
55 0.34
56 0.34
57 0.32
58 0.3
59 0.25
60 0.25
61 0.26
62 0.24
63 0.23
64 0.19
65 0.19
66 0.18
67 0.17
68 0.15
69 0.12
70 0.16
71 0.16
72 0.18
73 0.19
74 0.18
75 0.21
76 0.24
77 0.23
78 0.22
79 0.25
80 0.25
81 0.31
82 0.4
83 0.47
84 0.52
85 0.62
86 0.69
87 0.74