Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WWK3

Protein Details
Accession A0A4Q4WWK3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-37QDSSQRMQTNQRRPKKHIPNLPPLGCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGNTTPRNGIQDSSQRMQTNQRRPKKHIPNLPPLGCGGGEYDPSKIKPDGGREGSTDVTRSAPIYIPERKQLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.39
4 0.39
5 0.48
6 0.51
7 0.53
8 0.57
9 0.63
10 0.64
11 0.71
12 0.81
13 0.81
14 0.81
15 0.8
16 0.78
17 0.79
18 0.8
19 0.73
20 0.63
21 0.52
22 0.43
23 0.33
24 0.26
25 0.16
26 0.08
27 0.09
28 0.09
29 0.1
30 0.11
31 0.12
32 0.14
33 0.13
34 0.16
35 0.18
36 0.23
37 0.3
38 0.33
39 0.34
40 0.32
41 0.35
42 0.34
43 0.31
44 0.26
45 0.19
46 0.16
47 0.15
48 0.14
49 0.13
50 0.13
51 0.16
52 0.21
53 0.28
54 0.31
55 0.37