Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q4WCK3

Protein Details
Accession A0A4Q4WCK3    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-75DYTVVTEGNKNKKKKKDGKKBasic
NLS Segment(s)
PositionSequence
65-75KNKKKKKDGKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.333, mito_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MSNTSGDKGGDKAAGDKSQEQPDYAIRRQFDPVPDQVNGPFDPPNYNPATGHRSGDYTVVTEGNKNKKKKKDGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.29
5 0.34
6 0.34
7 0.31
8 0.28
9 0.32
10 0.36
11 0.36
12 0.35
13 0.29
14 0.3
15 0.32
16 0.33
17 0.29
18 0.26
19 0.25
20 0.25
21 0.24
22 0.23
23 0.21
24 0.21
25 0.18
26 0.16
27 0.13
28 0.11
29 0.13
30 0.13
31 0.17
32 0.17
33 0.18
34 0.17
35 0.2
36 0.26
37 0.25
38 0.26
39 0.22
40 0.21
41 0.21
42 0.23
43 0.19
44 0.14
45 0.14
46 0.14
47 0.14
48 0.17
49 0.23
50 0.32
51 0.4
52 0.47
53 0.55
54 0.63
55 0.74