Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WK10

Protein Details
Accession A0A4Q4WK10   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
109-128SLRRLGFRRRFARKKPPINEBasic
NLS Segment(s)
PositionSequence
113-124LGFRRRFARKKP
Subcellular Location(s) mito 14, nucl 10, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MPRPKGVQTRQLREDERQRCRTLYYDALFSISEISRITSFSADQIKTAVRTKDAKPAPRSGRPPVLDGKLLYALELFVTASKVHRFITYLKVSISFMDGMYGLYTIRSSLRRLGFRRRFARKKPPINEDIRMLRLEWAELYANWTMEQWEQILWTDETWVNDVTHRQQYCTRRVGEEYYPDCVDDKPKRKQGWMFWGSFSGATGKGPGIFWEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.72
4 0.71
5 0.67
6 0.61
7 0.6
8 0.55
9 0.5
10 0.49
11 0.41
12 0.37
13 0.34
14 0.33
15 0.3
16 0.27
17 0.24
18 0.15
19 0.14
20 0.11
21 0.13
22 0.11
23 0.12
24 0.13
25 0.11
26 0.11
27 0.15
28 0.21
29 0.19
30 0.19
31 0.2
32 0.21
33 0.23
34 0.27
35 0.25
36 0.22
37 0.27
38 0.29
39 0.37
40 0.42
41 0.47
42 0.46
43 0.54
44 0.57
45 0.61
46 0.64
47 0.61
48 0.63
49 0.56
50 0.55
51 0.51
52 0.46
53 0.4
54 0.35
55 0.3
56 0.25
57 0.23
58 0.19
59 0.14
60 0.11
61 0.09
62 0.09
63 0.06
64 0.04
65 0.05
66 0.05
67 0.07
68 0.08
69 0.09
70 0.1
71 0.1
72 0.12
73 0.13
74 0.21
75 0.21
76 0.21
77 0.21
78 0.21
79 0.21
80 0.19
81 0.19
82 0.11
83 0.08
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.06
94 0.07
95 0.08
96 0.14
97 0.18
98 0.25
99 0.28
100 0.39
101 0.45
102 0.53
103 0.6
104 0.65
105 0.69
106 0.71
107 0.79
108 0.78
109 0.81
110 0.79
111 0.77
112 0.74
113 0.71
114 0.66
115 0.6
116 0.53
117 0.45
118 0.38
119 0.31
120 0.26
121 0.2
122 0.18
123 0.13
124 0.11
125 0.1
126 0.09
127 0.11
128 0.1
129 0.1
130 0.1
131 0.1
132 0.1
133 0.09
134 0.1
135 0.08
136 0.07
137 0.07
138 0.08
139 0.11
140 0.1
141 0.1
142 0.12
143 0.13
144 0.14
145 0.15
146 0.15
147 0.13
148 0.14
149 0.17
150 0.19
151 0.25
152 0.25
153 0.26
154 0.32
155 0.39
156 0.45
157 0.49
158 0.46
159 0.42
160 0.44
161 0.47
162 0.44
163 0.46
164 0.41
165 0.4
166 0.37
167 0.35
168 0.33
169 0.29
170 0.33
171 0.34
172 0.41
173 0.46
174 0.55
175 0.58
176 0.64
177 0.71
178 0.71
179 0.72
180 0.7
181 0.63
182 0.56
183 0.54
184 0.48
185 0.4
186 0.32
187 0.23
188 0.16
189 0.14
190 0.14
191 0.13
192 0.13
193 0.13
194 0.15