Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N613

Protein Details
Accession G9N613   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VKNVPPERPKTPKTPRTPRTPKTPTGHydrophilic
NLS Segment(s)
PositionSequence
150-192EERREELRRRREEEEQRRKLPATASARGARGTAAGLRRARGRT
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Pfam View protein in Pfam  
PF08651  DASH_Duo1  
Amino Acid Sequences MADHMEIDDDSDLWTSPVKNVPPERPKTPKTPRTPRTPKTPTGNDRQSEPLDREAMLRRELEGVRSINRVIEGVIGTLQRTGSNMDSVSKTVSNASTLLNTWTRILSQTEHNQRLILDPTWKGATNDLAEIEAEALRKQQAEARKAAEEEERREELRRRREEEEQRRKLPATASARGARGTAAGLRRARGRTRVASVGSRIATRSSYSSSNTTSIPSSSRGASGTGRGIGTTRSRYSRAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.13
4 0.19
5 0.21
6 0.29
7 0.35
8 0.45
9 0.52
10 0.58
11 0.64
12 0.67
13 0.69
14 0.72
15 0.76
16 0.76
17 0.77
18 0.81
19 0.8
20 0.83
21 0.88
22 0.84
23 0.84
24 0.81
25 0.78
26 0.77
27 0.8
28 0.75
29 0.75
30 0.77
31 0.67
32 0.63
33 0.6
34 0.54
35 0.49
36 0.45
37 0.38
38 0.31
39 0.3
40 0.3
41 0.31
42 0.3
43 0.28
44 0.25
45 0.22
46 0.26
47 0.25
48 0.24
49 0.22
50 0.21
51 0.21
52 0.23
53 0.22
54 0.18
55 0.18
56 0.16
57 0.11
58 0.11
59 0.09
60 0.08
61 0.09
62 0.08
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.09
69 0.08
70 0.1
71 0.1
72 0.11
73 0.12
74 0.13
75 0.14
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.12
86 0.12
87 0.12
88 0.11
89 0.11
90 0.1
91 0.11
92 0.12
93 0.11
94 0.15
95 0.23
96 0.3
97 0.32
98 0.32
99 0.31
100 0.3
101 0.3
102 0.27
103 0.2
104 0.15
105 0.13
106 0.14
107 0.15
108 0.15
109 0.14
110 0.12
111 0.13
112 0.11
113 0.11
114 0.1
115 0.09
116 0.08
117 0.08
118 0.08
119 0.06
120 0.06
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.1
127 0.16
128 0.19
129 0.21
130 0.24
131 0.24
132 0.25
133 0.26
134 0.29
135 0.26
136 0.27
137 0.29
138 0.29
139 0.28
140 0.32
141 0.37
142 0.39
143 0.46
144 0.49
145 0.49
146 0.52
147 0.61
148 0.69
149 0.73
150 0.76
151 0.74
152 0.7
153 0.68
154 0.64
155 0.57
156 0.48
157 0.45
158 0.41
159 0.36
160 0.38
161 0.38
162 0.38
163 0.36
164 0.34
165 0.25
166 0.18
167 0.16
168 0.15
169 0.14
170 0.2
171 0.21
172 0.22
173 0.28
174 0.32
175 0.35
176 0.37
177 0.41
178 0.4
179 0.44
180 0.47
181 0.45
182 0.44
183 0.43
184 0.42
185 0.37
186 0.32
187 0.28
188 0.24
189 0.22
190 0.2
191 0.2
192 0.19
193 0.2
194 0.23
195 0.26
196 0.27
197 0.28
198 0.27
199 0.26
200 0.24
201 0.23
202 0.21
203 0.21
204 0.2
205 0.19
206 0.2
207 0.19
208 0.2
209 0.2
210 0.21
211 0.21
212 0.22
213 0.21
214 0.19
215 0.19
216 0.21
217 0.26
218 0.29
219 0.31
220 0.33