Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WWG8

Protein Details
Accession A0A4Q4WWG8   
Localization Confidence High
Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-37DSPPPRKRSRSDERSFSPRRQRDQDRARDYDRBasic
143-168FRGYRQRSPSPRRRDRDRERERERESBasic
NLS Segment(s)
PositionSequence
11-15RKRSR
108-127RDRPRPKKSFGGFKYKDKRR
135-181DAGRRGGSFRGYRQRSPSPRRRDRDRERERERESGAASSSKKSKSKG
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MADRGDSPPPRKRSRSDERSFSPRRQRDQDRARDYDRRDRGRDDYRPRNEDRYRGSDRDSGRDRRDRDTDRARDYDDQPKRRDGRGGGDRDTYPGDDEGERRDERTDRDRPRPKKSFGGFKYKDKRRDDDTDDRDAGRRGGSFRGYRQRSPSPRRRDRDRERERERESGAASSSKKSKSKGSGADSSQPPTRAPAAPSGGGGGEPMIIVHVNDRLGTKAAIPCLASDTIKNFKIMVAARIGREPHEILLKRQGMRPFKDMLTLADYEISNGVQLDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.79
4 0.8
5 0.77
6 0.81
7 0.8
8 0.8
9 0.8
10 0.77
11 0.77
12 0.77
13 0.79
14 0.8
15 0.84
16 0.86
17 0.83
18 0.81
19 0.79
20 0.77
21 0.75
22 0.74
23 0.73
24 0.71
25 0.67
26 0.65
27 0.66
28 0.68
29 0.71
30 0.71
31 0.72
32 0.73
33 0.75
34 0.75
35 0.76
36 0.71
37 0.69
38 0.66
39 0.64
40 0.62
41 0.58
42 0.58
43 0.54
44 0.52
45 0.53
46 0.54
47 0.53
48 0.54
49 0.59
50 0.58
51 0.58
52 0.65
53 0.61
54 0.63
55 0.65
56 0.65
57 0.63
58 0.62
59 0.6
60 0.56
61 0.55
62 0.56
63 0.55
64 0.55
65 0.52
66 0.58
67 0.58
68 0.55
69 0.56
70 0.48
71 0.48
72 0.5
73 0.51
74 0.45
75 0.45
76 0.42
77 0.39
78 0.38
79 0.28
80 0.2
81 0.16
82 0.15
83 0.12
84 0.13
85 0.14
86 0.18
87 0.18
88 0.18
89 0.2
90 0.2
91 0.24
92 0.31
93 0.37
94 0.39
95 0.5
96 0.59
97 0.64
98 0.72
99 0.75
100 0.71
101 0.71
102 0.69
103 0.69
104 0.64
105 0.68
106 0.61
107 0.63
108 0.69
109 0.68
110 0.72
111 0.66
112 0.65
113 0.6
114 0.64
115 0.62
116 0.62
117 0.59
118 0.56
119 0.52
120 0.48
121 0.43
122 0.37
123 0.29
124 0.19
125 0.16
126 0.11
127 0.12
128 0.16
129 0.16
130 0.21
131 0.3
132 0.33
133 0.34
134 0.39
135 0.46
136 0.51
137 0.6
138 0.64
139 0.65
140 0.72
141 0.76
142 0.8
143 0.82
144 0.83
145 0.84
146 0.85
147 0.85
148 0.83
149 0.85
150 0.8
151 0.74
152 0.65
153 0.56
154 0.47
155 0.38
156 0.31
157 0.26
158 0.23
159 0.21
160 0.24
161 0.27
162 0.28
163 0.29
164 0.34
165 0.37
166 0.43
167 0.48
168 0.49
169 0.5
170 0.5
171 0.56
172 0.51
173 0.47
174 0.43
175 0.36
176 0.3
177 0.26
178 0.27
179 0.21
180 0.21
181 0.23
182 0.24
183 0.23
184 0.23
185 0.21
186 0.17
187 0.15
188 0.13
189 0.08
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.07
198 0.07
199 0.08
200 0.09
201 0.1
202 0.11
203 0.11
204 0.13
205 0.14
206 0.15
207 0.16
208 0.16
209 0.15
210 0.17
211 0.18
212 0.16
213 0.15
214 0.19
215 0.23
216 0.24
217 0.24
218 0.21
219 0.2
220 0.25
221 0.25
222 0.22
223 0.23
224 0.25
225 0.25
226 0.29
227 0.29
228 0.26
229 0.28
230 0.27
231 0.22
232 0.29
233 0.3
234 0.29
235 0.38
236 0.42
237 0.41
238 0.45
239 0.51
240 0.5
241 0.53
242 0.54
243 0.49
244 0.43
245 0.46
246 0.42
247 0.37
248 0.33
249 0.29
250 0.25
251 0.24
252 0.23
253 0.19
254 0.19
255 0.16
256 0.11
257 0.11
258 0.1
259 0.07
260 0.07
261 0.08
262 0.07