Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4X0G5

Protein Details
Accession A0A4Q4X0G5   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-60MASNITKPKKPKSKRTPVRLKHKIEKASAAKQRKAKKEAKKNPQWKSKLKKDPGIPNLFPHydrophilic
69-88IEEGRRRKQEEQQRRRELAKBasic
NLS Segment(s)
PositionSequence
7-54KPKKPKSKRTPVRLKHKIEKASAAKQRKAKKEAKKNPQWKSKLKKDPG
72-84GRRRKQEEQQRRR
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR030378  G_CP_dom  
IPR014813  Gnl3_N_dom  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS51721  G_CP  
Amino Acid Sequences MASNITKPKKPKSKRTPVRLKHKIEKASAAKQRKAKKEAKKNPQWKSKLKKDPGIPNLFPYKEKILHEIEEGRRRKQEEQQRRRELAKAAKTGDREDQDAEETVEGAEGAGLEGLGESGDDMMDEDGVDESNPMAALIASARAAAEKYDRELQSGDDMDEDGESSDDDDMDLEEGGAELPGTMSSRKAYDKVFKQVVDQADVVLYVLDARDPEGTRSREVERMVMAAASGGKRLMLVLNKVDLIPPPVLKRWLTHLRRYFPALPLRASNPAPNAQTFNHRDITVQSTSAALFKSLKSFAASKQLKRPISVGVIGYPNVGKSSVINALLSRLGGRGAAACPAGAEAGVTTSIRAVKIDKQLTLLDSPGIVFPSASDGDESTSRNKKKKAIEAHAHLVLLNAVPPKQIDDPLPAVSLLLRRLSASPELLQKLMNVYDLPPLVPNANGDPTTDFLVQVARKRGRLGRGGVPNLPAAAMTVITDWRDGRIQGWVDAPVLPVAVDGGAAAAATKTADAQSGAIPDQKEIVTEWAKEFKLEGLWGDDEGAEKDDAMEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.94
3 0.95
4 0.94
5 0.95
6 0.94
7 0.92
8 0.91
9 0.9
10 0.86
11 0.8
12 0.79
13 0.76
14 0.76
15 0.76
16 0.75
17 0.72
18 0.72
19 0.77
20 0.77
21 0.79
22 0.78
23 0.79
24 0.82
25 0.86
26 0.89
27 0.9
28 0.91
29 0.91
30 0.93
31 0.91
32 0.9
33 0.9
34 0.89
35 0.89
36 0.88
37 0.86
38 0.84
39 0.86
40 0.85
41 0.84
42 0.74
43 0.69
44 0.69
45 0.62
46 0.54
47 0.48
48 0.45
49 0.41
50 0.42
51 0.41
52 0.37
53 0.37
54 0.4
55 0.44
56 0.45
57 0.49
58 0.51
59 0.5
60 0.52
61 0.54
62 0.55
63 0.56
64 0.59
65 0.61
66 0.69
67 0.75
68 0.79
69 0.8
70 0.77
71 0.73
72 0.7
73 0.68
74 0.66
75 0.61
76 0.55
77 0.55
78 0.54
79 0.53
80 0.52
81 0.44
82 0.37
83 0.33
84 0.3
85 0.28
86 0.27
87 0.24
88 0.17
89 0.15
90 0.12
91 0.1
92 0.08
93 0.06
94 0.05
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.02
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.09
133 0.1
134 0.13
135 0.21
136 0.21
137 0.23
138 0.23
139 0.23
140 0.24
141 0.24
142 0.21
143 0.14
144 0.14
145 0.12
146 0.11
147 0.1
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.05
158 0.05
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.05
170 0.06
171 0.07
172 0.1
173 0.12
174 0.14
175 0.18
176 0.25
177 0.3
178 0.37
179 0.4
180 0.38
181 0.39
182 0.42
183 0.39
184 0.34
185 0.28
186 0.21
187 0.16
188 0.16
189 0.14
190 0.08
191 0.06
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.07
198 0.07
199 0.1
200 0.17
201 0.19
202 0.21
203 0.24
204 0.25
205 0.26
206 0.26
207 0.25
208 0.19
209 0.18
210 0.16
211 0.13
212 0.11
213 0.07
214 0.08
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.06
221 0.07
222 0.08
223 0.09
224 0.1
225 0.11
226 0.12
227 0.12
228 0.12
229 0.1
230 0.11
231 0.1
232 0.11
233 0.12
234 0.13
235 0.16
236 0.16
237 0.16
238 0.22
239 0.31
240 0.34
241 0.41
242 0.46
243 0.47
244 0.48
245 0.53
246 0.48
247 0.42
248 0.45
249 0.38
250 0.32
251 0.3
252 0.3
253 0.28
254 0.27
255 0.23
256 0.19
257 0.2
258 0.2
259 0.19
260 0.2
261 0.17
262 0.24
263 0.25
264 0.26
265 0.25
266 0.24
267 0.24
268 0.23
269 0.27
270 0.2
271 0.17
272 0.14
273 0.12
274 0.12
275 0.13
276 0.11
277 0.07
278 0.08
279 0.08
280 0.1
281 0.1
282 0.1
283 0.11
284 0.13
285 0.13
286 0.23
287 0.27
288 0.27
289 0.35
290 0.42
291 0.42
292 0.41
293 0.41
294 0.33
295 0.31
296 0.3
297 0.22
298 0.16
299 0.17
300 0.16
301 0.15
302 0.12
303 0.1
304 0.08
305 0.08
306 0.06
307 0.05
308 0.08
309 0.1
310 0.1
311 0.11
312 0.1
313 0.11
314 0.11
315 0.11
316 0.09
317 0.06
318 0.06
319 0.05
320 0.06
321 0.06
322 0.06
323 0.07
324 0.07
325 0.06
326 0.06
327 0.06
328 0.06
329 0.05
330 0.04
331 0.03
332 0.03
333 0.04
334 0.04
335 0.04
336 0.05
337 0.06
338 0.06
339 0.07
340 0.09
341 0.14
342 0.22
343 0.24
344 0.24
345 0.25
346 0.26
347 0.27
348 0.26
349 0.21
350 0.13
351 0.11
352 0.11
353 0.09
354 0.09
355 0.07
356 0.06
357 0.05
358 0.09
359 0.09
360 0.09
361 0.09
362 0.09
363 0.1
364 0.13
365 0.14
366 0.17
367 0.25
368 0.31
369 0.37
370 0.41
371 0.47
372 0.53
373 0.61
374 0.65
375 0.66
376 0.69
377 0.69
378 0.71
379 0.65
380 0.57
381 0.47
382 0.37
383 0.27
384 0.18
385 0.14
386 0.1
387 0.08
388 0.08
389 0.09
390 0.12
391 0.13
392 0.15
393 0.15
394 0.18
395 0.21
396 0.22
397 0.22
398 0.19
399 0.17
400 0.16
401 0.17
402 0.14
403 0.12
404 0.11
405 0.12
406 0.13
407 0.16
408 0.17
409 0.17
410 0.18
411 0.23
412 0.24
413 0.24
414 0.23
415 0.21
416 0.21
417 0.19
418 0.17
419 0.12
420 0.11
421 0.14
422 0.14
423 0.14
424 0.13
425 0.13
426 0.13
427 0.13
428 0.14
429 0.13
430 0.16
431 0.15
432 0.16
433 0.16
434 0.17
435 0.2
436 0.19
437 0.16
438 0.13
439 0.18
440 0.2
441 0.24
442 0.32
443 0.32
444 0.33
445 0.38
446 0.44
447 0.45
448 0.49
449 0.49
450 0.49
451 0.54
452 0.56
453 0.54
454 0.5
455 0.44
456 0.37
457 0.31
458 0.22
459 0.14
460 0.1
461 0.08
462 0.07
463 0.07
464 0.08
465 0.09
466 0.11
467 0.1
468 0.12
469 0.14
470 0.14
471 0.14
472 0.2
473 0.21
474 0.21
475 0.23
476 0.22
477 0.2
478 0.21
479 0.21
480 0.14
481 0.12
482 0.1
483 0.08
484 0.07
485 0.06
486 0.05
487 0.04
488 0.04
489 0.03
490 0.03
491 0.04
492 0.03
493 0.03
494 0.04
495 0.04
496 0.05
497 0.06
498 0.07
499 0.08
500 0.09
501 0.11
502 0.13
503 0.15
504 0.18
505 0.18
506 0.17
507 0.19
508 0.18
509 0.17
510 0.16
511 0.22
512 0.22
513 0.23
514 0.27
515 0.31
516 0.31
517 0.3
518 0.3
519 0.25
520 0.24
521 0.23
522 0.21
523 0.19
524 0.2
525 0.2
526 0.2
527 0.18
528 0.16
529 0.16
530 0.17
531 0.12
532 0.11