Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WM61

Protein Details
Accession A0A4Q4WM61   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-24TTTTRDRYRAPPPRPRREINMHydrophilic
NLS Segment(s)
PositionSequence
43-48RRRRRW
Subcellular Location(s) nucl 15, mito_nucl 12.333, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPSTTTTRDRYRAPPPRPRREINMDHSWADFSSDSSAGRSSTRRRRRWFARLLERLKALFGGRSRREVSEIVTGPGSSSVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.8
4 0.82
5 0.8
6 0.77
7 0.76
8 0.75
9 0.72
10 0.7
11 0.62
12 0.55
13 0.51
14 0.43
15 0.34
16 0.28
17 0.2
18 0.12
19 0.11
20 0.1
21 0.1
22 0.1
23 0.11
24 0.09
25 0.11
26 0.13
27 0.2
28 0.3
29 0.4
30 0.48
31 0.54
32 0.62
33 0.69
34 0.76
35 0.77
36 0.76
37 0.77
38 0.78
39 0.75
40 0.7
41 0.63
42 0.54
43 0.45
44 0.36
45 0.26
46 0.21
47 0.21
48 0.27
49 0.27
50 0.33
51 0.35
52 0.35
53 0.37
54 0.34
55 0.33
56 0.33
57 0.32
58 0.28
59 0.27
60 0.25
61 0.22
62 0.25