Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1XPP2

Protein Details
Accession A0A4V1XPP2    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
208-233AIRELKPPTFRYRRNRRTSCYGARPSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 7, cyto 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032534  EcxA_zinc-bd  
IPR024079  MetalloPept_cat_dom_sf  
IPR006026  Peptidase_Metallo  
Gene Ontology GO:0008237  F:metallopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF16313  DUF4953  
Amino Acid Sequences MASSAQSHAGHHHCATQRRPDTRLRVGTNGRIPRWKRGSTVTYIVRTESFPNPDMAAYTTGKLVEAVSMWEDKGVKFQLVYRTCKATFQVVYQPADNHPDVYAEAFFPNNDSPTKRTLIVYGLALKAGNRRYLANIFAHELGHIMGLRHEFAARSDSEETGSVLWGKENDSSIMNYPDMLSKLRVQKQDLDELESFYESTEKKHEELAIRELKPPTFRYRRNRRTSCYGARPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.52
4 0.57
5 0.58
6 0.61
7 0.63
8 0.65
9 0.67
10 0.7
11 0.64
12 0.63
13 0.64
14 0.67
15 0.67
16 0.66
17 0.6
18 0.61
19 0.59
20 0.61
21 0.64
22 0.59
23 0.53
24 0.54
25 0.55
26 0.51
27 0.57
28 0.52
29 0.49
30 0.46
31 0.44
32 0.37
33 0.34
34 0.32
35 0.29
36 0.27
37 0.23
38 0.24
39 0.23
40 0.22
41 0.22
42 0.19
43 0.18
44 0.15
45 0.14
46 0.13
47 0.13
48 0.13
49 0.12
50 0.1
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.09
58 0.09
59 0.09
60 0.13
61 0.13
62 0.12
63 0.11
64 0.15
65 0.23
66 0.28
67 0.33
68 0.31
69 0.35
70 0.35
71 0.37
72 0.34
73 0.3
74 0.26
75 0.24
76 0.29
77 0.27
78 0.28
79 0.27
80 0.27
81 0.23
82 0.26
83 0.24
84 0.17
85 0.13
86 0.12
87 0.12
88 0.11
89 0.11
90 0.07
91 0.07
92 0.07
93 0.06
94 0.08
95 0.08
96 0.08
97 0.09
98 0.11
99 0.12
100 0.15
101 0.17
102 0.16
103 0.16
104 0.16
105 0.16
106 0.15
107 0.14
108 0.13
109 0.12
110 0.11
111 0.11
112 0.1
113 0.12
114 0.13
115 0.14
116 0.13
117 0.14
118 0.16
119 0.18
120 0.2
121 0.17
122 0.17
123 0.16
124 0.16
125 0.16
126 0.13
127 0.11
128 0.09
129 0.08
130 0.07
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.07
138 0.08
139 0.1
140 0.09
141 0.12
142 0.13
143 0.13
144 0.14
145 0.14
146 0.14
147 0.12
148 0.12
149 0.09
150 0.08
151 0.08
152 0.08
153 0.09
154 0.1
155 0.11
156 0.11
157 0.12
158 0.13
159 0.15
160 0.17
161 0.15
162 0.14
163 0.14
164 0.15
165 0.15
166 0.15
167 0.15
168 0.18
169 0.27
170 0.34
171 0.38
172 0.38
173 0.44
174 0.46
175 0.53
176 0.48
177 0.46
178 0.4
179 0.37
180 0.35
181 0.28
182 0.24
183 0.15
184 0.18
185 0.12
186 0.15
187 0.19
188 0.21
189 0.21
190 0.25
191 0.29
192 0.31
193 0.35
194 0.42
195 0.44
196 0.43
197 0.47
198 0.47
199 0.45
200 0.44
201 0.45
202 0.47
203 0.48
204 0.56
205 0.62
206 0.71
207 0.78
208 0.84
209 0.89
210 0.86
211 0.86
212 0.87
213 0.86