Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WPY6

Protein Details
Accession A0A4Q4WPY6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MLRQIKPRSARSKRALEKKAPKNVENHydrophilic
50-71YELRRPLSKKFTKKNEIHPFESHydrophilic
NLS Segment(s)
PositionSequence
6-22KPRSARSKRALEKKAPK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR039770  Rpf2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0019843  F:rRNA binding  
GO:0000470  P:maturation of LSU-rRNA  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MLRQIKPRSARSKRALEKKAPKNVENPKTVLFLRGTSCSQIVQDALTDLYELRRPLSKKFTKKNEIHPFESAASLEFFSEKNDCSILCFGSSSKKRPHALTIVRTFDHKTLDMLELHLDPESFRRISQFKTRKFAIGLRPMMVFSGTAFESPVNNEYTMFKSMFIDMFKGEVSDKIDVEGLQYIVSISADEPTGDDAKPTIRLRLYLITTKRSGQKLPRVEVEEMGPRMDFRVGRMNEPEEAVWKEAMKKPRSTEEKTKKNVSTDLLGDKMGRIHLGRQDLSELQTRKMKGLKRNKDLDDGADNEVAETTKRQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.87
5 0.86
6 0.88
7 0.84
8 0.78
9 0.77
10 0.79
11 0.77
12 0.71
13 0.65
14 0.57
15 0.54
16 0.51
17 0.45
18 0.36
19 0.31
20 0.28
21 0.29
22 0.28
23 0.26
24 0.26
25 0.23
26 0.21
27 0.2
28 0.17
29 0.13
30 0.12
31 0.11
32 0.1
33 0.09
34 0.09
35 0.08
36 0.09
37 0.12
38 0.12
39 0.13
40 0.19
41 0.21
42 0.27
43 0.37
44 0.45
45 0.52
46 0.62
47 0.71
48 0.75
49 0.8
50 0.85
51 0.85
52 0.82
53 0.76
54 0.68
55 0.61
56 0.52
57 0.46
58 0.35
59 0.24
60 0.18
61 0.14
62 0.12
63 0.1
64 0.09
65 0.1
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.13
72 0.15
73 0.13
74 0.12
75 0.12
76 0.12
77 0.21
78 0.26
79 0.29
80 0.35
81 0.41
82 0.44
83 0.46
84 0.51
85 0.51
86 0.54
87 0.57
88 0.56
89 0.52
90 0.49
91 0.49
92 0.45
93 0.37
94 0.32
95 0.24
96 0.17
97 0.16
98 0.18
99 0.16
100 0.15
101 0.14
102 0.12
103 0.12
104 0.11
105 0.09
106 0.07
107 0.09
108 0.11
109 0.1
110 0.1
111 0.14
112 0.15
113 0.19
114 0.3
115 0.37
116 0.39
117 0.45
118 0.46
119 0.44
120 0.45
121 0.46
122 0.44
123 0.43
124 0.39
125 0.35
126 0.33
127 0.31
128 0.29
129 0.23
130 0.15
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.09
140 0.08
141 0.08
142 0.09
143 0.1
144 0.12
145 0.14
146 0.13
147 0.12
148 0.11
149 0.12
150 0.13
151 0.11
152 0.1
153 0.08
154 0.08
155 0.08
156 0.08
157 0.07
158 0.07
159 0.09
160 0.1
161 0.09
162 0.09
163 0.1
164 0.09
165 0.1
166 0.09
167 0.07
168 0.06
169 0.06
170 0.05
171 0.05
172 0.05
173 0.04
174 0.03
175 0.04
176 0.04
177 0.04
178 0.05
179 0.06
180 0.08
181 0.08
182 0.08
183 0.07
184 0.09
185 0.15
186 0.15
187 0.17
188 0.16
189 0.17
190 0.2
191 0.24
192 0.26
193 0.27
194 0.29
195 0.3
196 0.31
197 0.34
198 0.38
199 0.36
200 0.38
201 0.39
202 0.45
203 0.48
204 0.5
205 0.52
206 0.51
207 0.49
208 0.45
209 0.4
210 0.36
211 0.3
212 0.26
213 0.21
214 0.16
215 0.16
216 0.18
217 0.15
218 0.12
219 0.21
220 0.22
221 0.25
222 0.29
223 0.3
224 0.28
225 0.29
226 0.27
227 0.21
228 0.21
229 0.2
230 0.17
231 0.16
232 0.2
233 0.25
234 0.33
235 0.35
236 0.38
237 0.41
238 0.5
239 0.57
240 0.59
241 0.65
242 0.67
243 0.72
244 0.74
245 0.79
246 0.73
247 0.69
248 0.65
249 0.57
250 0.51
251 0.45
252 0.42
253 0.35
254 0.32
255 0.28
256 0.24
257 0.22
258 0.18
259 0.16
260 0.13
261 0.16
262 0.21
263 0.27
264 0.27
265 0.26
266 0.3
267 0.29
268 0.31
269 0.35
270 0.32
271 0.3
272 0.35
273 0.35
274 0.36
275 0.4
276 0.45
277 0.47
278 0.56
279 0.63
280 0.66
281 0.75
282 0.74
283 0.75
284 0.7
285 0.65
286 0.6
287 0.53
288 0.46
289 0.39
290 0.35
291 0.27
292 0.25
293 0.21
294 0.15
295 0.17