Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WAP9

Protein Details
Accession A0A4Q4WAP9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
157-182GIESGDKPKNNKKKTKSTIKKWFIYFHydrophilic
NLS Segment(s)
PositionSequence
165-172KNNKKKTK
Subcellular Location(s) mito 14, cyto 6, cyto_nucl 5, extr 4
Family & Domain DBs
Amino Acid Sequences MATTPPHNLPLALRRLFADQLRDLVGRLRAADPTVDAAADALIDDMLPPCLTCKKADAGAFGPVAGDRRFNAADLRELALGLCVLDPGAGAAALEEITGHRKGRKTEKVAVGVGSGPLGLQVPGTPTPTSRFTTDSGSSGGSASSSAPSSSSSSVAGIESGDKPKNNKKKTKSTIKKWFIYFLEPQEYVNEGIAFRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.37
4 0.36
5 0.33
6 0.26
7 0.27
8 0.29
9 0.28
10 0.24
11 0.25
12 0.25
13 0.2
14 0.21
15 0.2
16 0.18
17 0.18
18 0.18
19 0.15
20 0.15
21 0.14
22 0.12
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.04
29 0.03
30 0.03
31 0.03
32 0.04
33 0.05
34 0.05
35 0.05
36 0.07
37 0.1
38 0.12
39 0.12
40 0.15
41 0.17
42 0.22
43 0.23
44 0.25
45 0.23
46 0.25
47 0.24
48 0.21
49 0.18
50 0.14
51 0.15
52 0.12
53 0.11
54 0.08
55 0.12
56 0.13
57 0.13
58 0.15
59 0.14
60 0.16
61 0.17
62 0.17
63 0.14
64 0.13
65 0.13
66 0.1
67 0.09
68 0.06
69 0.05
70 0.03
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.03
84 0.05
85 0.07
86 0.08
87 0.1
88 0.13
89 0.17
90 0.27
91 0.35
92 0.38
93 0.45
94 0.5
95 0.51
96 0.49
97 0.45
98 0.37
99 0.29
100 0.23
101 0.15
102 0.09
103 0.05
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.06
110 0.07
111 0.1
112 0.09
113 0.1
114 0.14
115 0.18
116 0.2
117 0.19
118 0.2
119 0.2
120 0.25
121 0.26
122 0.24
123 0.21
124 0.19
125 0.18
126 0.16
127 0.14
128 0.09
129 0.08
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.09
136 0.11
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.12
143 0.1
144 0.08
145 0.09
146 0.11
147 0.15
148 0.18
149 0.2
150 0.26
151 0.36
152 0.46
153 0.54
154 0.61
155 0.66
156 0.74
157 0.82
158 0.88
159 0.89
160 0.89
161 0.91
162 0.9
163 0.88
164 0.8
165 0.77
166 0.68
167 0.63
168 0.57
169 0.52
170 0.5
171 0.43
172 0.41
173 0.35
174 0.35
175 0.3
176 0.26
177 0.21
178 0.14