Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4UYL0

Protein Details
Accession A0A4Q4UYL0   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
294-317KKAEMAKKDGHRERRPRLNEYRASBasic
NLS Segment(s)
PositionSequence
267-342EERAPKPKEHVRRPHLMGLGAKEDEELKKAEMAKKDGHRERRPRLNEYRASKESERRSREDRRPESYKNERDREKY
346-373HGHRNGDRDRDRGRDRESHRSHDRHHRR
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MSEQTAQAPRIAIKFGANSSTAKPKIGLKNHSSSKPSSSLGKRQRSHAFSHDSDSAEDDELGGRHKLVTTFGANGAENDAERRGHKVSKGQGAAAPFVISGHKNRDWKSEARARKGNNLLPHEVQAQAENRASKETDPADQDKQIKWGLTVTKKERAEISTNPDEAAEERHKLPEQKTERDSDATKQPNDVDGEAMDALLGKKRKSARDFVIKDASGREESPRISEQDVYRRGLEEAAEVSTIEEYDAIPDGEFGAAMLRGMGWKGEERAPKPKEHVRRPHLMGLGAKEDEELKKAEMAKKDGHRERRPRLNEYRASKESERRSREDRRPESYKNERDREKYSYSHGHRNGDRDRDRGRDRESHRSHDRHHRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.24
4 0.23
5 0.23
6 0.26
7 0.34
8 0.32
9 0.3
10 0.31
11 0.36
12 0.44
13 0.51
14 0.55
15 0.52
16 0.61
17 0.67
18 0.72
19 0.67
20 0.61
21 0.58
22 0.54
23 0.49
24 0.49
25 0.49
26 0.53
27 0.59
28 0.66
29 0.63
30 0.66
31 0.73
32 0.68
33 0.67
34 0.65
35 0.62
36 0.54
37 0.56
38 0.52
39 0.44
40 0.4
41 0.36
42 0.3
43 0.23
44 0.21
45 0.16
46 0.13
47 0.12
48 0.14
49 0.12
50 0.1
51 0.1
52 0.12
53 0.12
54 0.12
55 0.16
56 0.15
57 0.17
58 0.19
59 0.2
60 0.19
61 0.18
62 0.18
63 0.15
64 0.13
65 0.13
66 0.13
67 0.12
68 0.12
69 0.16
70 0.18
71 0.21
72 0.24
73 0.3
74 0.35
75 0.43
76 0.43
77 0.41
78 0.4
79 0.38
80 0.35
81 0.28
82 0.21
83 0.13
84 0.12
85 0.12
86 0.11
87 0.12
88 0.18
89 0.23
90 0.28
91 0.3
92 0.37
93 0.4
94 0.42
95 0.47
96 0.5
97 0.52
98 0.55
99 0.6
100 0.55
101 0.59
102 0.62
103 0.58
104 0.56
105 0.54
106 0.5
107 0.45
108 0.44
109 0.37
110 0.31
111 0.26
112 0.22
113 0.19
114 0.17
115 0.19
116 0.18
117 0.17
118 0.18
119 0.18
120 0.15
121 0.19
122 0.18
123 0.19
124 0.21
125 0.25
126 0.26
127 0.29
128 0.32
129 0.28
130 0.3
131 0.28
132 0.24
133 0.2
134 0.22
135 0.24
136 0.26
137 0.33
138 0.34
139 0.4
140 0.4
141 0.41
142 0.39
143 0.37
144 0.35
145 0.31
146 0.35
147 0.31
148 0.31
149 0.3
150 0.28
151 0.24
152 0.2
153 0.22
154 0.17
155 0.14
156 0.15
157 0.17
158 0.18
159 0.22
160 0.23
161 0.27
162 0.31
163 0.35
164 0.37
165 0.38
166 0.38
167 0.37
168 0.37
169 0.31
170 0.33
171 0.32
172 0.3
173 0.28
174 0.26
175 0.26
176 0.26
177 0.23
178 0.15
179 0.1
180 0.1
181 0.09
182 0.08
183 0.06
184 0.05
185 0.05
186 0.08
187 0.09
188 0.08
189 0.13
190 0.18
191 0.25
192 0.29
193 0.35
194 0.39
195 0.48
196 0.51
197 0.51
198 0.53
199 0.46
200 0.43
201 0.37
202 0.33
203 0.23
204 0.21
205 0.18
206 0.15
207 0.15
208 0.18
209 0.18
210 0.18
211 0.18
212 0.21
213 0.22
214 0.28
215 0.31
216 0.3
217 0.29
218 0.28
219 0.27
220 0.24
221 0.21
222 0.13
223 0.11
224 0.09
225 0.09
226 0.08
227 0.07
228 0.07
229 0.06
230 0.05
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.06
239 0.05
240 0.05
241 0.04
242 0.04
243 0.04
244 0.04
245 0.04
246 0.03
247 0.04
248 0.04
249 0.04
250 0.05
251 0.07
252 0.09
253 0.15
254 0.21
255 0.24
256 0.34
257 0.37
258 0.39
259 0.45
260 0.51
261 0.56
262 0.6
263 0.68
264 0.64
265 0.71
266 0.72
267 0.72
268 0.66
269 0.59
270 0.51
271 0.43
272 0.41
273 0.32
274 0.26
275 0.2
276 0.2
277 0.18
278 0.17
279 0.15
280 0.12
281 0.15
282 0.2
283 0.25
284 0.28
285 0.32
286 0.38
287 0.44
288 0.53
289 0.59
290 0.65
291 0.69
292 0.74
293 0.8
294 0.82
295 0.82
296 0.8
297 0.82
298 0.81
299 0.8
300 0.77
301 0.77
302 0.69
303 0.7
304 0.66
305 0.65
306 0.65
307 0.66
308 0.66
309 0.63
310 0.68
311 0.72
312 0.76
313 0.78
314 0.76
315 0.74
316 0.76
317 0.76
318 0.77
319 0.78
320 0.78
321 0.77
322 0.78
323 0.77
324 0.75
325 0.75
326 0.72
327 0.67
328 0.6
329 0.57
330 0.59
331 0.57
332 0.62
333 0.62
334 0.64
335 0.63
336 0.68
337 0.68
338 0.68
339 0.67
340 0.64
341 0.64
342 0.64
343 0.67
344 0.65
345 0.64
346 0.64
347 0.65
348 0.69
349 0.7
350 0.7
351 0.74
352 0.74
353 0.75