Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WLR1

Protein Details
Accession A0A4Q4WLR1    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-113LATKDERASRQQRKQRKNRQKTLRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
89-120RASRQQRKQRKNRQKTLRGTAKVKGAKAKKEK
Subcellular Location(s) nucl 12, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MASTEVTLRTRNDILHPGQAGISKEDLRERLSSLYKATADQVNVFGLRTQFGGGKTTGFALVYDSPEAMKKFEPKYRLVRVGLATKDERASRQQRKQRKNRQKTLRGTAKVKGAKAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.29
5 0.28
6 0.3
7 0.27
8 0.22
9 0.23
10 0.18
11 0.18
12 0.21
13 0.22
14 0.21
15 0.21
16 0.21
17 0.22
18 0.24
19 0.24
20 0.22
21 0.24
22 0.22
23 0.21
24 0.22
25 0.2
26 0.17
27 0.17
28 0.16
29 0.14
30 0.13
31 0.13
32 0.12
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.11
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.1
55 0.1
56 0.11
57 0.15
58 0.2
59 0.24
60 0.27
61 0.31
62 0.38
63 0.44
64 0.47
65 0.43
66 0.42
67 0.41
68 0.44
69 0.4
70 0.36
71 0.3
72 0.26
73 0.27
74 0.25
75 0.25
76 0.27
77 0.36
78 0.42
79 0.51
80 0.59
81 0.67
82 0.77
83 0.86
84 0.89
85 0.9
86 0.91
87 0.92
88 0.94
89 0.94
90 0.92
91 0.92
92 0.91
93 0.87
94 0.8
95 0.75
96 0.73
97 0.69
98 0.63
99 0.62
100 0.59