Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q4WBJ4

Protein Details
Accession A0A4Q4WBJ4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
129-154YGDATPTKKRQRRTPAPKKRATVFKSHydrophilic
NLS Segment(s)
PositionSequence
82-107PKAKAGPKKGASSASARGTGTGGRKR
136-148KKRQRRTPAPKKR
Subcellular Location(s) cyto 14, nucl 10, mito 3
Family & Domain DBs
Amino Acid Sequences MADSNNTNEGAGGKWTDAEKASLMVQIIDQLTSAGGKVRLGELNMPGRTPKSLMHMLGKIKDEAAAHKGEGGSGSGSVPATPKAKAGPKKGASSASARGTGTGGRKRTKTVTAATGSDAGDDGEKDGDYGDATPTKKRQRRTPAPKKRATVFKSESKAEDTVSEDGGDEKKPDTVAAEAADVVNAAIAAANGAAALDGVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.15
5 0.15
6 0.14
7 0.14
8 0.15
9 0.14
10 0.14
11 0.12
12 0.11
13 0.13
14 0.12
15 0.11
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.11
26 0.13
27 0.14
28 0.16
29 0.18
30 0.24
31 0.24
32 0.24
33 0.23
34 0.23
35 0.23
36 0.22
37 0.19
38 0.18
39 0.22
40 0.24
41 0.27
42 0.31
43 0.32
44 0.35
45 0.35
46 0.29
47 0.25
48 0.24
49 0.2
50 0.18
51 0.18
52 0.15
53 0.13
54 0.14
55 0.14
56 0.12
57 0.12
58 0.1
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.08
67 0.09
68 0.09
69 0.1
70 0.13
71 0.2
72 0.27
73 0.31
74 0.38
75 0.41
76 0.43
77 0.44
78 0.43
79 0.38
80 0.35
81 0.33
82 0.26
83 0.24
84 0.21
85 0.19
86 0.18
87 0.18
88 0.2
89 0.2
90 0.23
91 0.24
92 0.25
93 0.28
94 0.3
95 0.31
96 0.3
97 0.28
98 0.29
99 0.28
100 0.28
101 0.26
102 0.25
103 0.21
104 0.18
105 0.15
106 0.1
107 0.08
108 0.07
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.1
119 0.11
120 0.15
121 0.22
122 0.32
123 0.37
124 0.43
125 0.51
126 0.58
127 0.69
128 0.77
129 0.81
130 0.83
131 0.88
132 0.9
133 0.85
134 0.82
135 0.8
136 0.72
137 0.71
138 0.65
139 0.63
140 0.6
141 0.57
142 0.52
143 0.46
144 0.43
145 0.34
146 0.3
147 0.25
148 0.21
149 0.19
150 0.17
151 0.14
152 0.15
153 0.16
154 0.15
155 0.12
156 0.12
157 0.13
158 0.13
159 0.13
160 0.13
161 0.13
162 0.14
163 0.13
164 0.13
165 0.12
166 0.12
167 0.11
168 0.09
169 0.08
170 0.06
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03