Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9MZQ6

Protein Details
Accession G9MZQ6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-64ADTEEFRRIKRKQNKPAAPGGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01717  Sm_B  
Amino Acid Sequences MASNKLGKMAGYINYRMRVTLQDSRQLVGQMLAYDRHMNLVLADTEEFRRIKRKQNKPAAPGGSSSGQTVVQEEKRTLGLVIVRGAHIISLTVESPPPADPSARLGKTTTGGIASTLQAGPGVARPAGRGAAAPISLAGPAAGVGGGAPPPGFPSFPGAPGAPGAPGFGGRGGPPPGFPGQFPPPAGFPGAPGFPGAPGFPPGGPPPGFQPPPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.35
4 0.33
5 0.3
6 0.33
7 0.36
8 0.36
9 0.39
10 0.4
11 0.4
12 0.41
13 0.37
14 0.31
15 0.23
16 0.2
17 0.13
18 0.14
19 0.14
20 0.14
21 0.15
22 0.14
23 0.15
24 0.14
25 0.13
26 0.11
27 0.13
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.16
34 0.16
35 0.15
36 0.24
37 0.26
38 0.37
39 0.46
40 0.55
41 0.62
42 0.73
43 0.8
44 0.77
45 0.82
46 0.75
47 0.66
48 0.56
49 0.49
50 0.4
51 0.32
52 0.26
53 0.18
54 0.14
55 0.13
56 0.13
57 0.14
58 0.15
59 0.16
60 0.16
61 0.16
62 0.16
63 0.17
64 0.15
65 0.12
66 0.11
67 0.11
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.08
74 0.06
75 0.05
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.12
89 0.19
90 0.19
91 0.19
92 0.18
93 0.18
94 0.19
95 0.19
96 0.15
97 0.08
98 0.08
99 0.07
100 0.08
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.08
115 0.08
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.03
127 0.03
128 0.03
129 0.03
130 0.02
131 0.02
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.05
138 0.07
139 0.07
140 0.07
141 0.13
142 0.14
143 0.16
144 0.18
145 0.16
146 0.16
147 0.16
148 0.16
149 0.1
150 0.09
151 0.08
152 0.06
153 0.07
154 0.07
155 0.07
156 0.07
157 0.07
158 0.11
159 0.14
160 0.14
161 0.14
162 0.17
163 0.2
164 0.2
165 0.2
166 0.22
167 0.25
168 0.29
169 0.3
170 0.29
171 0.27
172 0.27
173 0.29
174 0.22
175 0.19
176 0.18
177 0.18
178 0.16
179 0.16
180 0.14
181 0.13
182 0.14
183 0.13
184 0.1
185 0.12
186 0.13
187 0.13
188 0.16
189 0.17
190 0.23
191 0.23
192 0.23
193 0.26
194 0.34
195 0.38