Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LGT9

Protein Details
Accession E2LGT9   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
176-201DVASHRSNQRRTKKIGSKIRRFVDSFHydrophilic
NLS Segment(s)
PositionSequence
185-206RRTKKIGSKIRRFVDSFARRKK
Subcellular Location(s) cysk 13, nucl 5.5, cyto_nucl 5.5, cyto 4.5, pero 4
Family & Domain DBs
KEGG mpr:MPER_05679  -  
Amino Acid Sequences MIAALGIMSDVDLLEIALDGLIPFDPITCCLLDSVAIEIKGQFKPLHSAASADPIYLFIGPFEWEDVDGMGCLKCPLDGSFAHWSLDPDGPGASVDADEHGLPQLEQEFSIGVRWDPEQYKVIEEYLRFKQYDPYSTAYAEDKGYPLLMYRNIGPEVDRQSVLNDEASSDGRDGIDVASHRSNQRRTKKIGSKIRRFVDSFARRKKHY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.04
10 0.04
11 0.06
12 0.06
13 0.08
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.12
22 0.12
23 0.12
24 0.12
25 0.13
26 0.17
27 0.16
28 0.18
29 0.16
30 0.14
31 0.2
32 0.21
33 0.23
34 0.19
35 0.21
36 0.19
37 0.25
38 0.24
39 0.18
40 0.17
41 0.15
42 0.15
43 0.13
44 0.12
45 0.05
46 0.06
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.07
54 0.06
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.09
65 0.09
66 0.14
67 0.19
68 0.2
69 0.2
70 0.19
71 0.19
72 0.19
73 0.2
74 0.15
75 0.1
76 0.09
77 0.09
78 0.08
79 0.08
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.04
86 0.04
87 0.05
88 0.05
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.05
100 0.06
101 0.06
102 0.09
103 0.1
104 0.12
105 0.14
106 0.14
107 0.16
108 0.15
109 0.16
110 0.15
111 0.15
112 0.17
113 0.2
114 0.22
115 0.21
116 0.21
117 0.27
118 0.28
119 0.31
120 0.3
121 0.29
122 0.28
123 0.28
124 0.29
125 0.22
126 0.21
127 0.18
128 0.15
129 0.12
130 0.11
131 0.11
132 0.09
133 0.09
134 0.1
135 0.1
136 0.11
137 0.12
138 0.15
139 0.15
140 0.16
141 0.16
142 0.18
143 0.22
144 0.24
145 0.23
146 0.2
147 0.21
148 0.22
149 0.22
150 0.19
151 0.13
152 0.11
153 0.13
154 0.14
155 0.13
156 0.12
157 0.11
158 0.1
159 0.1
160 0.1
161 0.08
162 0.1
163 0.1
164 0.14
165 0.17
166 0.2
167 0.25
168 0.33
169 0.41
170 0.48
171 0.58
172 0.62
173 0.66
174 0.74
175 0.78
176 0.81
177 0.84
178 0.85
179 0.85
180 0.86
181 0.85
182 0.81
183 0.73
184 0.67
185 0.67
186 0.66
187 0.66
188 0.67