Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RAV9

Protein Details
Accession A0A4R0RAV9    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
141-168SASSSRSRERDSKRRVPRRRSSSYESESHydrophilic
NLS Segment(s)
PositionSequence
87-107AKEKARAKESEPDRKRAKRGS
147-179SRERDSKRRVPRRRSSSYESESDRGRRRSRSRS
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039715  ZCCHC10  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
Amino Acid Sequences MSKYAPHRPSNSNPRATSSTICQKCLGTGHYTYQCKNTRPYVSRPSRTEQLEKPQVLAKLRAEGKPSVEVPEEFRSKSGTANKILEAKEKARAKESEPDRKRAKRGSSRSGSDSDSDSDSSGSDSDSDSSSGSDSDSGSSSASSSRSRERDSKRRVPRRRSSSYESESDRGRRRSRSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.6
4 0.53
5 0.49
6 0.51
7 0.45
8 0.46
9 0.41
10 0.37
11 0.36
12 0.36
13 0.31
14 0.25
15 0.24
16 0.29
17 0.36
18 0.39
19 0.38
20 0.44
21 0.47
22 0.46
23 0.49
24 0.49
25 0.5
26 0.52
27 0.58
28 0.6
29 0.64
30 0.69
31 0.68
32 0.67
33 0.65
34 0.64
35 0.63
36 0.57
37 0.57
38 0.57
39 0.53
40 0.48
41 0.45
42 0.43
43 0.39
44 0.38
45 0.28
46 0.27
47 0.3
48 0.3
49 0.3
50 0.28
51 0.27
52 0.27
53 0.27
54 0.22
55 0.2
56 0.19
57 0.2
58 0.25
59 0.25
60 0.21
61 0.21
62 0.21
63 0.19
64 0.24
65 0.26
66 0.24
67 0.26
68 0.27
69 0.28
70 0.3
71 0.3
72 0.29
73 0.26
74 0.23
75 0.27
76 0.29
77 0.29
78 0.28
79 0.29
80 0.28
81 0.34
82 0.39
83 0.43
84 0.42
85 0.49
86 0.53
87 0.57
88 0.6
89 0.58
90 0.61
91 0.6
92 0.66
93 0.68
94 0.66
95 0.65
96 0.62
97 0.58
98 0.5
99 0.41
100 0.35
101 0.26
102 0.21
103 0.18
104 0.15
105 0.13
106 0.11
107 0.11
108 0.09
109 0.07
110 0.06
111 0.06
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.07
122 0.08
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.09
129 0.12
130 0.13
131 0.16
132 0.23
133 0.28
134 0.33
135 0.42
136 0.51
137 0.59
138 0.66
139 0.73
140 0.77
141 0.83
142 0.88
143 0.89
144 0.9
145 0.9
146 0.89
147 0.87
148 0.84
149 0.83
150 0.78
151 0.75
152 0.7
153 0.63
154 0.6
155 0.6
156 0.61
157 0.6
158 0.61
159 0.64