Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RJS7

Protein Details
Accession A0A4R0RJS7    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-23MNKGKETRPKGPQTQNSEPVEHydrophilic
30-57AKKEKIKEQTKLRQRKFRARQKAEKLAAHydrophilic
NLS Segment(s)
PositionSequence
31-56KKEKIKEQTKLRQRKFRARQKAEKLA
Subcellular Location(s) nucl 24, cyto_nucl 13.833, mito_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MAMNKGKETRPKGPQTQNSEPVELSEEALAKKEKIKEQTKLRQRKFRARQKAEKLAAEAELKSAESSIPKRKHSNSGAKSTLLAASIFGVSIKPLGLAPLTTPGKKTDLLHFHLPLPHPNCTGPQKMFSHRALIEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.8
4 0.8
5 0.74
6 0.67
7 0.57
8 0.48
9 0.43
10 0.33
11 0.25
12 0.18
13 0.16
14 0.14
15 0.17
16 0.17
17 0.14
18 0.18
19 0.23
20 0.27
21 0.35
22 0.42
23 0.48
24 0.57
25 0.66
26 0.72
27 0.77
28 0.79
29 0.8
30 0.8
31 0.83
32 0.83
33 0.84
34 0.85
35 0.83
36 0.85
37 0.84
38 0.87
39 0.8
40 0.71
41 0.62
42 0.51
43 0.44
44 0.35
45 0.26
46 0.16
47 0.12
48 0.11
49 0.09
50 0.08
51 0.06
52 0.08
53 0.11
54 0.2
55 0.24
56 0.28
57 0.33
58 0.35
59 0.43
60 0.48
61 0.55
62 0.51
63 0.54
64 0.53
65 0.48
66 0.46
67 0.38
68 0.31
69 0.21
70 0.16
71 0.09
72 0.07
73 0.07
74 0.06
75 0.05
76 0.05
77 0.04
78 0.05
79 0.04
80 0.04
81 0.04
82 0.05
83 0.05
84 0.05
85 0.06
86 0.14
87 0.17
88 0.17
89 0.18
90 0.2
91 0.22
92 0.25
93 0.27
94 0.27
95 0.31
96 0.36
97 0.41
98 0.4
99 0.4
100 0.43
101 0.42
102 0.42
103 0.39
104 0.38
105 0.34
106 0.34
107 0.38
108 0.39
109 0.45
110 0.39
111 0.42
112 0.44
113 0.49
114 0.54
115 0.5
116 0.52