Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R0RHG3

Protein Details
Accession A0A4R0RHG3    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-23AGIRNDKKPYSRPPARPRASEGHydrophilic
164-191GPGPVRTKAPRQPKEKKKPKTMQELDSEHydrophilic
NLS Segment(s)
PositionSequence
150-183KAPRAPRAAAPVSNGPGPVRTKAPRQPKEKKKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MAGIRNDKKPYSRPPARPRASEGAWLHDKASGFKKNEQNASRPGRAVTVSEGNSKLVVSNLHYELTPKDLTYDRSGRSSGVAILFYETADEAATTKREFDGKLARGQPMQIEFDAGPPPRLQARRIASAPSLINRIQKPPLLERLADTPKAPRAPRAAAPVSNGPGPVRTKAPRQPKEKKKPKTMQELDSELEAFMKDDNAVTVQPAAPATAPAPAAGDVEMAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.84
3 0.84
4 0.81
5 0.78
6 0.75
7 0.67
8 0.66
9 0.57
10 0.54
11 0.51
12 0.47
13 0.4
14 0.35
15 0.33
16 0.28
17 0.34
18 0.34
19 0.33
20 0.41
21 0.49
22 0.53
23 0.61
24 0.61
25 0.59
26 0.6
27 0.64
28 0.59
29 0.52
30 0.46
31 0.39
32 0.36
33 0.32
34 0.27
35 0.25
36 0.24
37 0.26
38 0.26
39 0.24
40 0.24
41 0.22
42 0.18
43 0.13
44 0.12
45 0.11
46 0.14
47 0.15
48 0.15
49 0.15
50 0.16
51 0.15
52 0.18
53 0.16
54 0.12
55 0.13
56 0.15
57 0.18
58 0.23
59 0.27
60 0.25
61 0.26
62 0.27
63 0.25
64 0.24
65 0.22
66 0.17
67 0.13
68 0.12
69 0.1
70 0.1
71 0.1
72 0.09
73 0.08
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.07
83 0.08
84 0.09
85 0.09
86 0.12
87 0.19
88 0.2
89 0.26
90 0.28
91 0.28
92 0.27
93 0.27
94 0.25
95 0.19
96 0.18
97 0.12
98 0.12
99 0.11
100 0.12
101 0.15
102 0.13
103 0.12
104 0.11
105 0.12
106 0.15
107 0.16
108 0.16
109 0.21
110 0.24
111 0.28
112 0.29
113 0.3
114 0.26
115 0.27
116 0.27
117 0.21
118 0.21
119 0.17
120 0.22
121 0.21
122 0.24
123 0.23
124 0.24
125 0.25
126 0.26
127 0.32
128 0.29
129 0.28
130 0.26
131 0.31
132 0.33
133 0.31
134 0.27
135 0.23
136 0.26
137 0.32
138 0.31
139 0.28
140 0.29
141 0.33
142 0.36
143 0.4
144 0.38
145 0.34
146 0.37
147 0.36
148 0.33
149 0.29
150 0.26
151 0.19
152 0.2
153 0.21
154 0.2
155 0.22
156 0.24
157 0.31
158 0.38
159 0.49
160 0.54
161 0.62
162 0.71
163 0.76
164 0.84
165 0.87
166 0.89
167 0.89
168 0.9
169 0.89
170 0.9
171 0.86
172 0.81
173 0.77
174 0.72
175 0.62
176 0.53
177 0.45
178 0.33
179 0.26
180 0.19
181 0.13
182 0.09
183 0.08
184 0.07
185 0.07
186 0.08
187 0.09
188 0.09
189 0.09
190 0.11
191 0.11
192 0.12
193 0.12
194 0.11
195 0.1
196 0.11
197 0.11
198 0.12
199 0.12
200 0.11
201 0.12
202 0.12
203 0.12
204 0.11