Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RD48

Protein Details
Accession A0A4R0RD48    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-34ASAIKPSKSSTKKPPSKASKQPLPIPDRHydrophilic
NLS Segment(s)
PositionSequence
18-23KKPPSK
228-282KKADAPLEKKVRAKRVPKGVVPGVTPPPDPERWLKKSERSTFHSGHKRKKGGGGG
298-311GGGGGAKAKGKKKK
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013699  Signal_recog_part_SRP72_RNA-bd  
IPR026270  SRP72  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF08492  SRP72  
PF17004  SRP_TPR_like  
Amino Acid Sequences MPPISTASAIKPSKSSTKKPPSKASKQPLPIPDRLKRLFTSLCAQIDGGHFVNAVKTCDKILLLDPADQNALQTKLYLLLQTEQYAAALALIDDNGENAFERMYSLYRLHKEDEVESAVAELKETSSESDRGVIHLEAQLSYRQGSYQNAFNLYNELLETTEPDTEEHSDILTNLEATQKHLDFINSGYSRALSALPAAVTTGLETAPPPAPAQPSSLFAAAQSSGPKKADAPLEKKVRAKRVPKGVVPGVTPPPDPERWLKKSERSTFHSGHKRKKGGGGGGATQGAMESTAGAASGGGGGAKAKGKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.53
4 0.63
5 0.71
6 0.77
7 0.83
8 0.84
9 0.86
10 0.89
11 0.88
12 0.86
13 0.84
14 0.83
15 0.82
16 0.78
17 0.76
18 0.73
19 0.7
20 0.7
21 0.65
22 0.62
23 0.53
24 0.53
25 0.48
26 0.43
27 0.42
28 0.39
29 0.37
30 0.33
31 0.32
32 0.28
33 0.26
34 0.27
35 0.22
36 0.16
37 0.15
38 0.14
39 0.17
40 0.16
41 0.18
42 0.14
43 0.14
44 0.15
45 0.16
46 0.16
47 0.14
48 0.15
49 0.19
50 0.2
51 0.24
52 0.24
53 0.23
54 0.24
55 0.22
56 0.2
57 0.17
58 0.16
59 0.11
60 0.11
61 0.1
62 0.11
63 0.12
64 0.12
65 0.1
66 0.12
67 0.13
68 0.14
69 0.14
70 0.12
71 0.11
72 0.11
73 0.09
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.07
91 0.09
92 0.11
93 0.17
94 0.2
95 0.23
96 0.24
97 0.26
98 0.26
99 0.25
100 0.25
101 0.21
102 0.18
103 0.15
104 0.14
105 0.13
106 0.11
107 0.1
108 0.07
109 0.05
110 0.06
111 0.06
112 0.07
113 0.08
114 0.09
115 0.09
116 0.13
117 0.13
118 0.13
119 0.14
120 0.13
121 0.11
122 0.12
123 0.12
124 0.09
125 0.1
126 0.1
127 0.09
128 0.1
129 0.09
130 0.08
131 0.09
132 0.11
133 0.12
134 0.15
135 0.15
136 0.17
137 0.18
138 0.17
139 0.17
140 0.15
141 0.13
142 0.09
143 0.08
144 0.06
145 0.06
146 0.07
147 0.06
148 0.06
149 0.07
150 0.07
151 0.08
152 0.09
153 0.1
154 0.09
155 0.08
156 0.08
157 0.08
158 0.08
159 0.07
160 0.05
161 0.05
162 0.08
163 0.08
164 0.1
165 0.14
166 0.13
167 0.13
168 0.14
169 0.14
170 0.12
171 0.13
172 0.19
173 0.16
174 0.16
175 0.16
176 0.15
177 0.15
178 0.15
179 0.14
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.04
191 0.04
192 0.04
193 0.07
194 0.08
195 0.09
196 0.09
197 0.1
198 0.13
199 0.14
200 0.17
201 0.16
202 0.18
203 0.19
204 0.19
205 0.17
206 0.15
207 0.16
208 0.12
209 0.12
210 0.13
211 0.13
212 0.16
213 0.16
214 0.17
215 0.16
216 0.2
217 0.27
218 0.31
219 0.35
220 0.41
221 0.49
222 0.53
223 0.59
224 0.62
225 0.63
226 0.64
227 0.67
228 0.67
229 0.7
230 0.72
231 0.69
232 0.7
233 0.65
234 0.59
235 0.52
236 0.48
237 0.42
238 0.38
239 0.34
240 0.3
241 0.3
242 0.29
243 0.31
244 0.34
245 0.38
246 0.41
247 0.48
248 0.51
249 0.55
250 0.64
251 0.7
252 0.69
253 0.67
254 0.7
255 0.68
256 0.72
257 0.73
258 0.72
259 0.73
260 0.76
261 0.74
262 0.7
263 0.73
264 0.7
265 0.66
266 0.64
267 0.58
268 0.51
269 0.48
270 0.44
271 0.36
272 0.28
273 0.21
274 0.14
275 0.1
276 0.07
277 0.04
278 0.04
279 0.04
280 0.05
281 0.05
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.05
289 0.07
290 0.13
291 0.19