Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R0RJ07

Protein Details
Accession A0A4R0RJ07    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRILGHKRAKRNSRPNTSLVHydrophilic
NLS Segment(s)
PositionSequence
16-20KRAKR
Subcellular Location(s) mito 12.5, mito_nucl 10.5, nucl 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRILGHKRAKRNSRPNTSLVQIEGVATKEDAQFYLGKRVAFVYKAKKEIQGSKVRVIWGRVTRPHGNSGVVKSKFTSNIPPHAFGASVRVMLYPSRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.19
32 0.18
33 0.18
34 0.19
35 0.19
36 0.19
37 0.22
38 0.23
39 0.25
40 0.29
41 0.29
42 0.32
43 0.34
44 0.39
45 0.42
46 0.42
47 0.42
48 0.42
49 0.44
50 0.42
51 0.4
52 0.36
53 0.35
54 0.31
55 0.33
56 0.33
57 0.38
58 0.41
59 0.42
60 0.44
61 0.39
62 0.37
63 0.34
64 0.36
65 0.38
66 0.34
67 0.33
68 0.3
69 0.32
70 0.32
71 0.31
72 0.36
73 0.31
74 0.4
75 0.43
76 0.44
77 0.42
78 0.4
79 0.38
80 0.28
81 0.28
82 0.2
83 0.17
84 0.14
85 0.14
86 0.14